SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 119857.FTL_1013 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  119857.FTL_1013
Domain Number 1 Region: 2-77
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000204
Family Thioltransferase 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 119857.FTL_1013
Sequence length 243
Comment (Francisella tularensis holarctica)
Sequence
MNKQKAIIYRMVTDKHICPFGIKAKYLLKRKDYFVEDIHLKDRQQVDEFKNKYDVKTTPQ
IFIDGNRIGGYDDLVKFFGLVKDKQAKSYKPVIAVFAMTFLLALAFGYFIAGNIFALLTI
KVFMGLSIAFLAMLKLQNLDSFVNQFITYDLLAMRYLRYAYIYPFAEAFVGISIIAAIFS
YLAALIAIIIGLIGAISVFYAVYIQKRELKCACVGGNSNVPLGFLSLTENIMMIAMGIWM
IFM
Download sequence
Identical sequences A0A1R0HIH1
gi|89256352|ref|YP_513714.1| WP_003015872.1.12820 WP_003015872.1.1316 WP_003015872.1.15828 WP_003015872.1.21553 WP_003015872.1.2436 WP_003015872.1.30377 WP_003015872.1.34036 WP_003015872.1.43575 WP_003015872.1.44313 WP_003015872.1.44922 WP_003015872.1.48098 WP_003015872.1.54420 WP_003015872.1.5992 WP_003015872.1.65566 WP_003015872.1.73973 WP_003015872.1.77892 WP_003015872.1.80603 WP_003015872.1.84288 WP_003015872.1.93025 WP_003015872.1.95205 WP_003015872.1.96937 WP_003015872.1.99661 119857.FTL_1013 gi|422938747|ref|YP_007011894.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]