SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002423088 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002423088
Domain Number 1 Region: 29-254
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.13e-73
Family Lectin leg-like 0.0000000652
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002423088
Sequence length 496
Comment (Pediculus humanus corporis)
Sequence
MAAEVRWLFYLLPIYIFGLISGTIGTLPHRRFEYKYSFKPPYLAQKDGSVPFWEYGGNAI
ASSDNVRIAPSLKSQKGAIWTKSKTNFKWWEVEIVFRITGRGRLGADGLAFWYTANKGSY
DGTVFGSSDKWVGLGVMFDSFDNDNKHNNPYIMAVVNDGTREFDHANDGSSQLLGGCLRD
FRNKPFPTKAKIEYYNNVLTVLFHNGMTSNDQDYEMCFRYENVYLPEEGYFGLSAATGGL
ADDHDVIHFLTTSLHPPGHEQPSAQKVSVEEQQRLNQEYQEYQKKLQEQRDSYQREHPDA
KKDKDEFGDFFESDNQRELRQIFSVQSQVFDVLKDLHKKLDEIIGRQERTLSLISHQPMQ
VGSPPGTPPQMIDTINRREVDMVLQNQNAIIQVAREIRGFVGEVHSKSDIILQNQARQPT
AQVHYDMASVVNEMREGLNNVKQSLTVIIQRLSSSDSTCPPCLSATTFIVFSVIQLILML
GYSIYRQQEQRAKKFY
Download sequence
Identical sequences E0VAE4
XP_002423088.1.24195 vb|PHUM035550-PA|EEB10350.1|ERGIC-53 121224.XP_002423088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]