SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002423126 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002423126
Domain Number 1 Region: 334-533
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.74e-47
Family Laminin G-like module 0.00048
Further Details:      
 
Domain Number 2 Region: 540-730
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.81e-36
Family Laminin G-like module 0.00066
Further Details:      
 
Domain Number 3 Region: 120-321
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.16e-33
Family Laminin G-like module 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002423126
Sequence length 744
Comment (Pediculus humanus corporis)
Sequence
MNTTAETYIKDEEDEDILYQKDASISVELDTGNSDNYEYGINNNDDERGSGSRNTLLLLL
TTTLSPNLEQKVPVRTKSPGITESIKPTTSTPCTLDCGGGGSGGGGTGGGGICILDEEEQ
RCQCPLGTGGINCDLEVSIGSPWFTGNGWLAFPALQAAYKHVQLEMEFRPESWDGILFLT
GERDDMTGDFMSLLLHQGFLEFRFDCGSGVGVVRSEETVNLNEWNKLILYRHRWDAWIQL
NNGKHGLFSRITFREPVFIGGPGNTTGLSDKLPTESGFKGCIRYLDINDHTYSFEQYPNG
DAIKGFDVLECTSDKCSEVPCQHSGKCLLSGEEAICLCPLGFTGDLCQTRVPAFNGSSYL
RYPGLGNSVLSWLDIEMTLKPTSKDGVILYNGHRTDGVGDFMAISIHGGHFEFTFDLGTG
AASVRIEKPVTMGEWHELRLSRTGRFAILQVDDQAPVHALAPGAFTQLSLPQNLYIGGIP
NVDMVSPKVKIKTSFVGCIQKVVINDKPIKILAEALAGVNVANCPHPCVTQPCGAGKCVP
ILEYFTCECAEGYTDKECQEHEIPAMLDNIAIPRFTGSSYLHYISNEMKFTVRFNTKVEN
GLILWIGDQDSRGDHRSDFLLLGLSGGELHFRFNLGGGEVDISYNETSLSDGEWHEVTVR
RTGKRGELIVDGMTPIVRTVPGKLTQLNTNTGLYVGGIDNLKEDIINKYTSGLVGCISRL
VLDTDYDVKLMAMSTAGRNVQHCN
Download sequence
Identical sequences E0VAI2
121224.XP_002423126 XP_002423126.1.24195 vb|PHUM038420-PA|EEB10388.1|laminin

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]