SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002423964 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002423964
Domain Number 1 Region: 277-479
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.59e-43
Family Ribonuclease PH domain 1-like 0.000088
Further Details:      
 
Domain Number 2 Region: 6-129
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.32e-34
Family Ribonuclease PH domain 1-like 0.00019
Further Details:      
 
Domain Number 3 Region: 435-534
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.07e-21
Family Ribonuclease PH domain 2-like 0.00021
Further Details:      
 
Domain Number 4 Region: 212-308
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 4.71e-17
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0009
Further Details:      
 
Domain Number 5 Region: 130-219
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.82e-16
Family Ribonuclease PH domain 2-like 0.0069
Further Details:      
 
Domain Number 6 Region: 541-614
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000105
Family Eukaryotic type KH-domain (KH-domain type I) 0.0041
Further Details:      
 
Domain Number 7 Region: 614-692
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000182
Family Cold shock DNA-binding domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002423964
Sequence length 708
Comment (Pediculus humanus corporis)
Sequence
MIIGAGKLAKFTDGCATVTFKDTTVMATAVSSDKGGMYSGFVPLTVSFQQKAAALGRIPL
NFLRRELGQNENEILISRMIDRSLRPLFPANFNNETQIVCNPLAMDGENFPDVLSINAAS
AALAVSNIPWNGPVGAVRVGLVDDNIIINPDKNLLSKSSLNLVVVSKAKHYVVMLEGSCS
NILLNDLLRAIKKGVSECQKIIISIEHLASLCGKPKKEVNISEINEELYQSIQMLASEPL
NKIFQNSIHDKLSRDTAISEVRTLIEKKFSDKCENFNQIFSLVCKEVFRNYILINNIRCD
GRLPVELRNIECESNLFKPLHGSALFQRGQTQVFCTVALDSPSSALKMDRISMLTSGLKE
KNFFVHYEFPPFATKEIGKLGPIGRREIGHGSLAEKALKANIPENFPFTIRLTSEVLESN
GSSSMATVCGGTLALLDAGVPLIKECAGVAMGVVTKWDDDKSGIIDYVILTDILGIEDYF
GDMDMKVAGTKNHITAIQMDVKTPGLPIKIVMESITQAKQAISTTLTRMFKDVDLQKKVK
KDNWPVIEKLNVPVNQRAKFIGPGGINIKNFEMKTGVEITEENLGEFQIFAANKEALNEA
MKIINEKINSQKEPVLEFGAIYTATITEIREHGCMVILYPAMQPVLIPVTQLDHKKVSHP
SALNLKVGDQFKVKYFGRDPISGYMRLSRKVLHSPPSNVAQNFFETNS
Download sequence
Identical sequences E0VCX0
XP_002423964.1.24195 vb|PHUM098920-PA|EEB11226.1|polyribonucleotide 121224.XP_002423964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]