SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002424038 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002424038
Domain Number 1 Region: 92-153
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.00000000144
Family Insect pheromone/odorant-binding proteins 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002424038
Sequence length 160
Comment (Pediculus humanus corporis)
Sequence
MDSVSGGFVPMKSIYLRNKKLQIIPNGGGIGDFLSTAVQDGISTTSAFKSPTMFLGGFSI
LMQPLPNGTEFAGQFTQSLPHYFNLVPVLVHKNFNNDVIVVDNNFKCFIYCLYYNYGWMN
EKGNFKYVEMKNTLEESSLEESSIEYLLDSCTEIANVCSI
Download sequence
Identical sequences E0VD44
XP_002424038.1.24195 vb|PHUM105570-PA|EEB11300.1|hypothetical 121224.XP_002424038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]