SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002424941 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002424941
Domain Number 1 Region: 322-427
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.49e-28
Family Calponin-homology domain, CH-domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002424941
Sequence length 983
Comment (Pediculus humanus corporis)
Sequence
MGSVWKRLQRVNKRAAKFQFTVSYHQLLLETTSKWKPNKLSVVWTRRSRRVVTDPLPWEP
TLKDPLRGIVVWAVPENKEVSVTLFKDQRTQELEDKDWTFILEDVSVTGKRRQIAATNIN
MKKYASVESSQVQLNLTLKPMTKKIVFASLECTLSCVFLREGKATDEDMQSMASLLSANN
NSDIAPLEDFDEEDIDVDVDVSLKNEILDLSSHIEYLTNSLSDSEFASTPISVASVPSLQ
KDDPTPIADEFKTILTQPFNEVLTNVNSNFNEIHSSSNVINEEKDNEDKTRDPSENKDQK
NVRLKLQPLNFNQVNTKTRPMESTPGLDLLEWCKEVTKGYNGVKVTNLTTSWRNGMAFCA
VIHHFRPDLIDYDSLLSHDIKGNCKKAFDAGEVLGISRIIEPAAMDVLTVPDKLAVMTYL
YQLRAHFTGHELEVKQIGKTTDESSYMVGRFNSDNSDVAIEFFGQEIMNLRKRESGDFNK
ALEERSSSVDSVKNTEKSIENEPQAQVNSRQNSILKLRLPLLSNQDSVGDFEGDNSRHES
KERSPTSVKEVKDKILASSKSILEKVLSPTKDKVTFNRDKSKSPPVKSSRPILMTRRQYS
DPFGSDEEDEMTAQDVNVINSTEEKKFKTNHSSIPISYSVDSELNRPKQFHEYENKLLNS
PSNEIPSRNQNRTLSRHNELRERARQLLEQAKKEAASRGNFTQSQSLTPLKDEEERQQQL
RERARKLIAEARMGVVSPTSPNPLVIKIRSPLSEENLIGKRESPDKKSPSPSENSLKGET
NGNIWSWNGYNQKGSVQQKINSPDEDYLTKDRISPDKENEYGKEIGNYIQNELEALEREQ
KQIDKQAALLEKELRKVMESGNNSEQEEIMMTNWFTLVNKKNALLRRQMQLNILEKEENL
ERRFELLNRELRCILSLEDWQKTEEQKVREALLLDELVSIVNKRDELVHHLDSQEKAIED
DHEIQRDITRASMMQRNRNCVVQ
Download sequence
Identical sequences E0VFP7
121224.XP_002424941 vb|PHUM164050-PA|EEB12203.1|protein XP_002424941.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]