SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002425161 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002425161
Domain Number 1 Region: 56-234
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.1e-35
Family SPRY domain 0.02
Further Details:      
 
Domain Number 2 Region: 1214-1265
Classification Level Classification E-value
Superfamily RING/U-box 0.000000155
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Weak hits

Sequence:  121224.XP_002425161
Domain Number - Region: 705-779
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0576
Family Arfaptin, Rac-binding fragment 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002425161
Sequence length 1294
Comment (Pediculus humanus corporis)
Sequence
MEVSDILARIFNHEFRLRTDDDNKIKFSEDLNRWVTTNLDSQVPCFLPVIDNRSGRIGPS
NVKFDVSAHFGLFIIGSERLSVHSQSNFSSILCNVCVYQGKWQFEVQLGTKGVMQIGWAT
RGCRFSQETGVGDTFDSYAYDGNRIRKWNSYTQKYGQPWLSGDIIGCCGDFDKGTLEFFR
NGVSMGEAFDNVHLGPGRAYFPAVSLGFGEHLTANFGNTPFRYPVSGYEPLQIYPIQAVE
RCNVILDWFYNLLNIEETHSQVTPDGYLCKELNASPDAFFLTVSKTLVYALAPLLALPFL
TDSCIIPFIERLLGKDAGVILRSNKGKSMGSTGNRGRVVRWLDMLWAFLEERELKPFLEN
ICLQLLSRFRHVPSNLEYVEQKRSLSLLRSVCEHSRSRQLLLNHIFFDTVKLVEFLHVKM
LDESGLIAIIEHPWWDCHGTDKEVDDRKKPYLKSCNRIFEAVSSVESLQVDLLKCLMNNT
DGSNRQPSSRKIFLKRLRIFFHDNYMSTRSFHLMQTPLPVTLCCFHRLLVMFRELWESEV
GKRPVIVEPKVFYDGSINYYTVDRIGGVLSHLNKTYIQELTAVLGPDHKVVNKKVVQENP
SAARMIAPLDIVDGQFLPGFLGGPSIAIRVPPEAQGNGPGVGLPSVVPMLARLLQQANGG
PSGGPFGFDGSLGVLRPDKSRVSNGFVDNTQSLMELLDGLILFYHTSAHKQIVKVSAMRD
NMEDYVTAYENARTRLESFKNPSKAMRRESVAMIQSEIEKTRQVFESKLEEQARFMAWVR
AAIFSSEKQRQLSWLLNVLVSTIKASSSEGVLFSFLPEFYLDSLFEICSALRVLFHPTCS
LEDIDGFNQILAQLSEFLCVHFADPRIVNASSKDTVVQALATFVANPVTLQSLEKVSFET
QRNMVKGLLRPYENRAWAQSNWILVRFWQGYGFAFRYEKSPHLTKKVGPRFLQSDSAIIN
QYIKPLPSKLFQNHVKDVMINNEPMATVFLNSVLNQLNWAFSEFIGMLQEIQNISSRPER
VFIESRQLKICATCFDLSLSLLRVLEMICNISVCVFIDPERPNSELLLSRLYQLICQILN
RVSSTTGCFQHVVLLEIPDLEGVDHFPILAAVVGILLALFKDDLKNFRESNPISNVAHVL
LTEPSFQLSSLKFLLGDLRQQVENGKGKTLPVKSKGFSFSNYQGDVSDEELRDVRRLINL
LEVGQRKVSAMSLHSDDDVCTICYANPISVVFEPCRHQSCKVCIAHHLLNGRECFFCKSM
IEKVVDVHGIVVHDLGRITDGFDNNEEEEEEEDE
Download sequence
Identical sequences E0VGB7
121224.XP_002425161 XP_002425161.1.24195 vb|PHUM177460-PA|EEB12423.1|predicted

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]