SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002425576 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002425576
Domain Number 1 Region: 190-378
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.33e-25
Family Laminin G-like module 0.0033
Further Details:      
 
Domain Number 2 Region: 7-168
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-24
Family Laminin G-like module 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002425576
Sequence length 2347
Comment (Pediculus humanus corporis)
Sequence
KLLLIPFRSFYGASYIHVPLQDAKSTTDIHFRFKTKRSDSFLLLVAGRTDYCIIRLEFGK
LKIRINLGAGESEISSARGLKLDDLNWHEVFITRRDAEFVLVVDNIHITKEKLPGRFYEL
NIHYGIFLGSQGDFTELFLGHHESLRGCLSHVDYNGINVLKKARERIGQVDVQGVTWSCS
PEFEAGYDKEISFVENGAFMTLPNPITRSGTRWDFNVKISNHNGLLLYGSGLTSKSDYVA
VEIVDSQIRLIVDRGNGAAELISDDSISDGYWHSVTVFFTPTILEIIIDKKSSSLQLTPT
ENRYLDLDIGDVLFIGGMELNKRARALGQGIKSADVSIKGCLKNITFDGKRSGFPDAKIT
VGLLPDCVWEYHCNKNPCVENSICIQQGVESFKCECDNPPCVKPEYTDNYKIFSKTSLPR
DLEIIKLVPVITEEGKNSLITTDNIDVVLDYRKYGVRDSGLLFRILKPPEFGKISVENWD
KRGLSRQVFTLLDVAKDKIYYLHDGSENHHDVITFDMELSPESGFLLPGYLQGRHRFVLH
VNITPVNDPPHLELGPGKVLRLAQGTKKILSKDLLNAEDPDSPTSDLVYTVLNQGGKPEE
KGYLERIGRPGLKVDTFTQKEVDNNVIIYVHRGKESSNSRLALQVSDGIETSPPIFLRIS
SFPLEIRLLNNTGIILTHKSFMKITGQNLSFVTNAEDPTLEIRYEITKLPQYGVIQRFIN
LEKKNSDETFNGSSLWQVVEQFTSQQISREEIRYLHTNQSPSHDFFKFKVSVGQVKNPTE
YDFRVTFTKLSIEPISLEEIYLNGTKDAMITEKELEYVTKPLRTDKKNIVYEIINGPKYG
YLSLVTNKRQHLQDGDFFTQEDVERERFRYRLHRKGYSHIKDNFVYKIKVQNAETSPRIL
NIIYSPNQKLKNEVQVTLEGLQVDEGGRQVLLPTNLDLRANFITSLMYNVTQGPQFGRLE
IMDDSLQNILRKNSSYFTSEELFSEKVYYVHDDSETRSDRFNFVALSNEQEDFQYVGEFH
VNIILKNDNTPVRVIDKIFNVVINGEKLLTGRDLKYSDADIDTKPSDIIYTRRGIPNGGL
YLAKDPTKPVFEFTQDDLDKDLILFKHEGTEYGKIGLWITDGHFYANGLLEVKASPPYIL
INNTNLIAQSGKVTPITTSHLSSETNLNTQSHEITYNVIEPPQHGYIMLLPEEETLKSFT
QLELERKKVFYSHFGDSSVKDYFRFQVIAQDTTAERIFNIRIYPSSFWEDLITRNYTLYV
EESTSITITNNNLEVMHPNIAPSDIIYYVVKQPSYGTLEVDSVVATAADDSKDDSKNLIK
IFEQSTINDRHLHYVQEIANQTKDLIIMDVTNGITWIRGLELNIIVIPEVIYIQGGRFEC
LEGDSTQLPNTLFTVQNNYYQNKIIEYDIVEKPKHGFIYLFKKPETPIQKFTKQQYENGL
VQYRHDGSETIEDEFKIIGKTEDKESTIVTVNVKILEINDQKPYLVNNKGLELWEGSSAI
ITSKNLAVKDEDTLPEQILFTVTSVKTGHLALVTNPNKPILHFTQAQIDSSQILFLHKGG
LYGKFQFFFTDGETISEKINFNITAKVVKINLVNNENLQIFPTLKKPINSDLLLSVTSDH
TSSRGNSITYWIRKKPELGKLVLKDEKNNFVEVDRFTQSDVNDTKIWYHHTKKFRNFYAQ
DNFEFDVHAEFTHALVEQIFSINISVSSGGLDHFLDISTVEVKEGDSKTIRINTNELISF
LTIQAGLESPTIQIHLFKKPTHGQICYRSECNVTIFSQNQLNMGEIIYRHDNSDTLRDEI
NFWIYLEPGDVLLCNVTIPVKIIPVNDQPFSIITLSPHLTVVEGQKYVLTKHDLLTEDAD
TSPEDIVYDIINGPSQGTVSVLRNDTNNLDLSGRFTQEDINSGRVVYHHSGSIQPTSFYF
RVSDGKFNPTYTVFNIQVLPLILNITSSNPVYLQQCSSVALVTPDNFQIDTNGDVGNVKY
NVTKSPKNGVIYLGDVPSNFFTQNDLENKKVMYMQTVMSAPGDSFQLGGWIIEVENPPRV
EINVVIKPLIITGIFTPIVGTKNRLGLSVLDASPLAKVTNSNPVYEVIKKPRLGRLKKII
RSSGEKKNIKEKEIGRFSHEELKSGVIYYVTKKSIMADEIYGLDDLMILQLVASIFQPAK
VELKFKVVPETNLSVNSIDAISQQHPKMPASKNPISQDGGIRVASPNIKSDYLLILGMIV
GVLFLAIIVVIIVRCRTVKSEERKSNKQDLQGPLPLPRPPDDLMPSTGRIKNFTSSNGST
PNSIPQCKVIPIGPVDSITSSDLEINARYPYGISDDPVEDWSSYDTSETGYPHRTINPML
RRNQYWV
Download sequence
Identical sequences E0VHI2
121224.XP_002425576 XP_002425576.1.24195 vb|PHUM210160-PA|EEB12838.1|Chondroitin

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]