SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002425686 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002425686
Domain Number 1 Region: 224-297
Classification Level Classification E-value
Superfamily GAS2 domain-like 2.35e-26
Family GAS2 domain 0.00014
Further Details:      
 
Domain Number 2 Region: 14-65,101-180
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.76e-25
Family Calponin-homology domain, CH-domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002425686
Sequence length 844
Comment (Pediculus humanus corporis)
Sequence
MAGVLLEARPYRPFKSSEEYLYAMKEDLAEWLNILYSDLEITVDNFMDKLETGVVLCKHA
NSVKKSAEEYVARKHLKKMTSSQALTASIMTKTALPITKMGEIIYRLSAKPGTFFARDNV
SNFIDFCRHGLEIIECLLFETDDLIMRKNEKNVILCLLEVARRGAKFGMLAPILVQMERE
IDREIAAEQRLARGDTEDESSSEDEEECIVPYGPIPQIITNDLKNLDEMVRDLVEKCTCP
TQFPMIRVSEGKYRIGDTKVLIFVRILRSHVMVRVGGGWDTLSHYLDKHDPCRCRSGHKT
ALSSKLVLKNNGALELNNAQVLYERSPPRTRRSSASSSSSGHGGRDYRDFLPGYTNGVNR
SRSPTPKREGGKKGGLNPQKYISTILLDGTRRDTVSPKRGRSASPGAALHPSYNSPTMAS
RNRSRSPSLRNVDEQKKKISEVGTQQCDDVKYLTATQLTDAETEPSRRAKITLEAKDHVN
SEDSKHNDSGSEVSDEGYRSLGLIVTSPVMGEGKLVSNDIKSGKLKNCGSSSAEGSDPIE
SPTSESINSSANNERQSEEEPKKKINKKPSPIASADVSKSPLKTQTIKKKPTSRISSRSS
SPGGQIESQIPSRRYSAVNDANSCRRKSNKENEIRKTPRSRSATPGRYNSVETPIPPQNA
KSASENKFGTWNGKGKKRPGINSDGYSPSNFVRNSVGRSSLGSHSLPGGVKRIMQKSGES
KNNMSPLLADLLKTKNLNDDKTILLKMKEIINQYSGIFEESSSSSSSPDKKSDSNSDDLD
FTSEWVKNNGSLRKMENCSGDYNEKSSSPNKRKDVKYDGSQSKIPAPVFFKQQQQPQHVS
EKEY
Download sequence
Identical sequences E0VHR2
XP_002425686.1.24195 121224.XP_002425686 vb|PHUM215460-PA|EEB12948.1|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]