SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002426934 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002426934
Domain Number 1 Region: 68-119
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000023
Family SAM (sterile alpha motif) domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002426934
Sequence length 129
Comment (Pediculus humanus corporis)
Sequence
MENIRTEISSLRNQQNLNVRSQSIPRALNSLLASSPGNEKTDPSALTNPTRVKKLTKFFG
DEPPLLRLFLKKLGYEKYAGAFESEKIGMVELPYLTEERLQKMGIPMGPRLRILQEAQIS
FCRDSVYVV
Download sequence
Identical sequences E0VLE0
XP_002426934.1.24195 121224.XP_002426934 vb|PHUM286820-PA|EEB14196.1|conserved

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]