SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002427163 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002427163
Domain Number 1 Region: 22-253
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.23e-80
Family Calponin-homology domain, CH-domain 0.0000196
Further Details:      
 
Domain Number 2 Region: 291-414
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-33
Family Spectrin repeat 0.000002
Further Details:      
 
Domain Number 3 Region: 528-648
Classification Level Classification E-value
Superfamily Spectrin repeat 2.22e-28
Family Spectrin repeat 0.0000119
Further Details:      
 
Domain Number 4 Region: 415-524
Classification Level Classification E-value
Superfamily Spectrin repeat 3.14e-24
Family Spectrin repeat 0.00000625
Further Details:      
 
Domain Number 5 Region: 653-764
Classification Level Classification E-value
Superfamily Spectrin repeat 4.19e-21
Family Spectrin repeat 0.0000182
Further Details:      
 
Domain Number 6 Region: 765-913
Classification Level Classification E-value
Superfamily EF-hand 6.13e-20
Family EF-hand modules in multidomain proteins 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002427163
Sequence length 917
Comment (Pediculus humanus corporis)
Sequence
MVDYIGNNIDHQYGDGYMEQEEEWEREGLLDPAWEKQQKKVPWGNSHLKKAGTAIENIEK
DFRNGLKLMLLLEVISGETLPKPDRGKMRFHKIANVNKALDFIASKGVKLVSIGAEEIVD
GNLKMTLGMIWTIILRFAIQDISVEEMTAKEGLLLWCQRKTAPYKNVNVQNFHLSFKDGL
AFCALIHRHRPDLIDYNKLSKDNPLENLNTAFDVAEKYLDIPRMLDPEDLINTPKPDERA
IMTYVSCYYHAFQGAHQPDERVVMTYVSSYYHTFSGKQKAETAANRICKVLKVNQENERL
MEEYERLASDLLEWIKRTMPWLESRQTDNSLAGVQKKLEEYRTYRRKHKPPRVEQKAKLE
TNFNTLQTKLRLSNRPAYMPTEGKMVKDIANAWKGLETAEKSFEEWLLSEMMRLERLEHL
AQKFKHKADIHEDWTRGKEEMLQSQDFRQCKLNELKALKKKHEAFESDLAAHQDRVEQIA
AIAQELNSLDYHDSASVNARCQRICDQWDRLGSLTQRRCQALDEAERILEKIDILHLEFA
KRAAPFNNWLDGTREDLVDMFIVHTMEEIQGLIDAHNQFKATLGEADKEYNSIVGLVREV
ETIVKQYQIPGGLENPYTALTANDLVKKWSEVKQLVPQRDQTLQAEFRKQQNNEMVRRQF
AEKANQVGPWIERQMDAVTAIGMGLQGSLEDQLHRLKEYEQGVYAYKPHIEELEKIHQAV
QEGMIFENRYTQYTMETLRVGWEQLLTSINRNINEVENQILTRDSKGITQDQLNEFRSSF
NHFDKNRTGRLAPEELKSCLVSLGYSIGKDRQGEIDFHRILAVVDPNNSGYVTFDAFLDF
MTRESTDTDTAEQVIDSFRILAGDKPYILPDELRRELPPDQAEYCIKRMPPYKGPNGVPG
ALDYMSFSTALYGESDL
Download sequence
Identical sequences E0VM19
121224.XP_002427163 XP_002427163.1.24195 vb|PHUM299510-PA|EEB14425.1|alpha-actinin-4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]