SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002427477 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002427477
Domain Number 1 Region: 24-210
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-25
Family Laminin G-like module 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002427477
Sequence length 227
Comment (Pediculus humanus corporis)
Sequence
MFPWTGGQLFGGRTVLQDFSLEHDLIRAIKIPFEDPKTQFFDKGFDGFPAFGLLPGSDVK
VPYRIILPEKLYSEFTIQATVKLSSHDGGFLFAVVNPLETVVQLGIQITPANENPGHSNF
SLFYTDANTHFSSEIIASFDVFAFKVTSNNVTLYFNCHEYDSVQIKKSPSELIFDSASTL
YVGQAGPLLKGSFNGSLQELKLYGSANQAELQWSGEDEYNFSFVSLI
Download sequence
Identical sequences E0VMY3
XP_002427477.1.24195 121224.XP_002427477 vb|PHUM321590-PA|EEB14739.1|conserved

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]