SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002427538 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002427538
Domain Number 1 Region: 185-243
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0000049
Family VPS37 C-terminal domain-like 0.014
Further Details:      
 
Weak hits

Sequence:  121224.XP_002427538
Domain Number - Region: 5-38
Classification Level Classification E-value
Superfamily UBC-like 0.000136
Family UBC-related 0.065
Further Details:      
 
Domain Number - Region: 108-159
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0801
Family Calponin-homology domain, CH-domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002427538
Sequence length 257
Comment (Pediculus humanus corporis)
Sequence
MPMCLYITLPPEFPNEKPSIRVQPPVKHGWVSNNTDIDKAPGLLNFTAHSDLGRVVQVII
REFQIRPPMVVGCFSNSIGKFILPRNYNFVSSFPELISLSNEELQLLNSNPDKLDDFVSS
LKPCIDFNKLIESRFQDVETLAKNNLSKQGKLENVKKQIFSQMEQAKELKKSFEIKSKEF
ENLSQKYQPLNICHVLRLEAINSDEESEIIAEKFLNKEIDIEKFLLEYVEKRKISHIRKT
KEEKLSNQLKELQRANY
Download sequence
Identical sequences E0VN34
121224.XP_002427538 vb|PHUM327990-PA|EEB14800.1|odorant XP_002427538.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]