SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002427810 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002427810
Domain Number 1 Region: 11-113,141-248
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.18e-60
Family Calponin-homology domain, CH-domain 0.00011
Further Details:      
 
Domain Number 2 Region: 3057-3180
Classification Level Classification E-value
Superfamily Spectrin repeat 1.36e-19
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 3 Region: 4124-4276
Classification Level Classification E-value
Superfamily Spectrin repeat 1.78e-18
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 4 Region: 3911-4035
Classification Level Classification E-value
Superfamily Spectrin repeat 2.8e-16
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 5 Region: 3481-3635
Classification Level Classification E-value
Superfamily Spectrin repeat 4.09e-16
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number 6 Region: 4551-4692
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000102
Family Spectrin repeat 0.0099
Further Details:      
 
Domain Number 7 Region: 5208-5324
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000072
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 8 Region: 6396-6544
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000134
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number 9 Region: 2420-2569
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000167
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 10 Region: 5790-5906
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000249
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number 11 Region: 2634-2781
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000252
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 12 Region: 709-867
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000384
Family Spectrin repeat 0.0059
Further Details:      
 
Domain Number 13 Region: 1129-1282
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000588
Family Spectrin repeat 0.0076
Further Details:      
 
Domain Number 14 Region: 4334-4492
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000134
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 15 Region: 2846-2964
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000288
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 16 Region: 3714-3848
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000314
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 17 Region: 1030-1170
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000353
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 18 Region: 5418-5563
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000504
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number 19 Region: 4772-4910
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000133
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 20 Region: 6170-6328
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000155
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 21 Region: 3317-3434
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000228
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 22 Region: 5632-5754
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000298
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 23 Region: 4993-5116
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000454
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 24 Region: 511-646
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000372
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 25 Region: 1576-1710
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000122
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number 26 Region: 6911-7065
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000175
Family Spectrin repeat 0.0092
Further Details:      
 
Domain Number 27 Region: 4911-5025
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000666
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 28 Region: 6702-6815
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000117
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 29 Region: 7286-7396
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000756
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 30 Region: 841-960
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000756
Family Spectrin repeat 0.0071
Further Details:      
 
Domain Number 31 Region: 2203-2354
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000144
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number 32 Region: 5121-5216
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000216
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 33 Region: 1453-1563
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000249
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 34 Region: 1344-1493
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000296
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 35 Region: 4679-4782
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000175
Family Spectrin repeat 0.0083
Further Details:      
 
Domain Number 36 Region: 2970-3047
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000177
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 37 Region: 2093-2242
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000368
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number 38 Region: 6514-6613
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000046
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 39 Region: 6059-6219
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000864
Family Spectrin repeat 0.009
Further Details:      
 
Domain Number 40 Region: 1874-2029
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000888
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 41 Region: 5327-5432
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000247
Family Spectrin repeat 0.01
Further Details:      
 
Weak hits

Sequence:  121224.XP_002427810
Domain Number - Region: 1717-1823
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000452
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 653-732
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000691
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 3218-3325
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00147
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number - Region: 330-448
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00183
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number - Region: 7458-7552
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00576
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 6620-6711
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0104
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number - Region: 5994-6074
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0331
Family Spectrin repeat 0.0071
Further Details:      
 
Domain Number - Region: 3635-3753
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0345
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number - Region: 6827-6902
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0403
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 5897-6017
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0935
Family Spectrin repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002427810
Sequence length 7677
Comment (Pediculus humanus corporis)
Sequence
MILRAIFNFHLIFLRIPPLKIHDLIEDLKDGTKLLALLEVLSGERLQVERGKNLRRPHFL
SNANTALQFLANKKIKLVNINASDLVDGRPPVVLGLIWTIILYFQIEENTRALESLGHTF
GGSTSSLESISEKRPRLSTPSKANKVGAKRALLQWVARALPKDLNVEVKDFGPSWRDGIA
FLGVIEAIRAGLIDFETLKRATNRHRLETAFDVAENELGVARLLDPEDVDVDRPDERSIM
TYVAQFLHKYPEPNTDALANLQSEHTFLLNWLIQTTQSLQHMKDTNTLPMNYREFTTLRA
EALEKAKIYEKFGKIVDSQSIISISLEAWKEMEKLWILLENLLRYWEWLLDSKLLGLLGE
VVNWLSQAENLIYSDEIPHVMNEETAGIISRKLEEHKAFFANLPKVVEKFETCKKTCDLA
NVPPDQLRNIQNRIDSIGTRAARRRIKLKYYEHKCCLIAFLHLTETKLKNWTVKYGREEQ
VQQLLDQYKNFVSKNKIFQEFNKAFIDMQQVVEEYKREGDVDDRESLAIDQFMRNTNDRW
RSVSMELRCVQSMLEEVLAYWKRWNSSADEFEKWLERAYSMKDQPEDEKMEFFQDLSTWK
DKNQQLNDTVSFLVATCEEPIANELRERYGRMNILWEQLFPSIKHYMKAGDLYKHKKDYT
LGLEKLQKWLRSAEKTLSATPINSSESMKAYGDELKKLSIELEEMEELFKEISKKFQGLI
PDLTRDEVDQIMNTLKKEKESLVRIRAQIPVQMHLYHQILVQQESLEVGLNELKNWLDKA
DEHLSKYSLSNDPEELKENLNKHKQFFNRTLYYKSMLESKNKVYQNIIKNIDQSGGPVPI
EVTSNTKEINERFAKTIDLATQWEQKLINALQIWEIYLNNRKFVSDWLDKAEDLVKENDD
RTGIEEQKLFFEPLNESVIENFEKSGKELLKILPSEKQAPIKENINQLQRRWQNMSALAP
LHLLKIEFKLEEVLFLGLLNDIIKELTSQQTALDNGEEISRLTARSQEYFKNGKTVKDCE
KSLDNLKKISALYGQKNPKDALLKETFEKNQKQWSVAMKNAERLKAHLDQVPEKWVKYHQ
QYQEMVNWMDKVDENIKKLFKKTETLDDFNKERQEFQNICKEVEGKRETIKWLVQNLDDL
ISSRNDSEAEKEQKLLQNLIARYKALIPTIEMTVTQTELFIKCYTYKKEADDVCNLLKRV
GETSETTPHPETLNAVTQMITQQEAAVSNLDNQRSNIISMLQRGRELAKDPHAPTFVSEQ
VADLETKWNKAYNTTLEKLNKLKNTQKVWHNYKGQKKEISELLERAEQELKQMQGKPASR
DVVRELKEKQELSKALRQATEELLKRLRELCLSLTAVTAPERKPLLQKEVTDVEKRLQTT
LQSVENRVVFLEKLNNDWNKLHADLNDLRQWTIYSAPILVEALQTEETEPRERLNSAKVL
QRNLVGKIELTKQLEEKCKELTGDDDKNPDSQKIKAEIKSLGDSLKALKDSADNSEQAIV
SSIEVYEQHKSTADMLKPWLEKAQTQSASIAKPVTLQDIENQLVQAKVFQTECKKQYSQL
QGLPAVPKNVSITALEEVDNLKAKCEFIKTKADYQVQKCEKTIKAYEEFDKLTKAFENWV
DDIEKKLKNITKDSDLSQAPTWDEKSEKLKVLNREILSKQADLAKVKNASDDLCQGLAPE
GAVVVKNRVQELKNKVMKLGEEGQKQANFLADKIIERQDLDSKLDAFTKWANDFNDKLNS
TENVGFTYNDINAQEIHNLLLDHNERLPLLNSIIDQYNSMLTKTSSKEAKDMEKPFKKII
DQYKETEKRLHNKKQALDGWAEFLPFNNDVLEHLKYATTASQDTDSKLEFITALVQELDA
IKLKLESWKEPCNKIDDLCQKSNVVVKDQNGLPVTTNQLMAKMEKQYSSVADKLKQRQDT
LQAVRTRRNQFVDLQKKLSDDLAKTQEELLDVLRSVTTGQTFQPAIEKLKKLSEKQEKNL
PTKTKVHSEGSTLMKEDQTCIEPVQNFLTSVDSEWDKTDDILKVQQKRISDMLQAWENLL
TIKNNFNAELNDIKKNINDGKNSKDLSDSVIKSNLDQARKCLDQLKKLKNTFNTMTNKAN
FIIKQTENLENFDEKELEDLLKTAQEEWKNLCDDVVKRIQYLDTQNILWEQMEDEKNSIL
EWIKHCNDSFNVSLKNSEQMKGKLVKYNDDLPIYSNLKISAEAKADQLMKLNEGKNVKPV
QDIMKKLNDEFELLKLTAKKMQDMASSFGDQEQAVKKEIKKAGDLITQIREAVISCDDLT
GDNNRILQRFNNIQGYQKDLEGFHGALKQINETVKTMKNEFPDFGDSSLAKELSSLEKRY
ENVVSHANKVENNLRGYLTKYCNEKFGSFDRILKTLNEKLKWCIPDENNDRYNINLKLSS
LKDVENELEECKNKKSELDQSLQYLEKVENKENIDKFKVQKKKLLDDMEELNKMCKTVGE
KLKAGSQLWEKYDLMFENLASWLKENEGKIRSESYNQINIDEIPQKIKETEEFQKKIHLM
KPEINHLTELANEIANENPEARTKQYCSHLSTRYQAIVKFIDSHLERLENLKKSEQLYNN
AIQDVKQWLNESDDKLKKIEGNLVKPPKSLSEFQKQVDELKNFDKNKEKGQSLLNAAIEK
GEVLFLGTHPENRENIRSELRVLRSSMENLQDRINNMNKKVETIIMQRSSIDESYSQVEK
WLNDAKLKLEEKYEPKATLQEKKLSLHNYKLLYQDVKSRKNMLEQLQEKVASLSDDDSTK
KLENMTKEYDNLIKTIESRMKLAEKDVLSHEKFLLSLEKFHDWLETLKAEAAPVVFAVDA
EKESAVVRLDCLDNLLRHKDEGDEMLKVCKDNLKDALSGTSASGQPALQKEVENENKEWV
EFLQKCENMRDKLNQFCNKFTELENRVEELSNWTKNHELQVKDQSLKSTYEAKLQHLNKL
KNLEKDIQKKGEEFNKVNDDSKDVERDSDLVGKVSKLNARYQGLKNLAKESIAKYEVYST
EHKAFNDNYNKFDKWLTDTEKTLQEQSGIVGDVGFLQEKQKKLRELNDLKNKENVTFDAL
LDAGEKLYVHTSPEGREIIRQQIRTMRSKWENIGTELQNTIEKVDECLVQFAEFALKQEE
LTKWLKEVEKAMQQHMELKNNLQEKRAQLQNHKIIHQEILGHQDLVDGVCEKARRLVDQT
KDTSLNVYLNSIGKLFHDIVLQSQGLLESLEKNVENDTKFSNECKDFRDWLSFEKDKLQE
CSDSTGERHDIQKRSASLQTHYQNIKEGEGKIDKVKDAFNVVAKSTAPKGLLTAEKEKDT
LVENFKQYQDDIGVIDKKLNDSIKNWQDFEQLLDEHSKWFKEAEVIFRQDKLLGSLPEKE
AELKLLKEKRNSITEREPKIDEFVDKGHSLFNLTGTERIMPLISQISNKYQSLLTQSKEM
VNRWQDLVDAHKAFVDKLKETEDWLTAFEKRLNDVKNDSDLPSKSEKLKVLLSENEQAPH
KLTNLATMAENLYPETSAAGREQIRNSLKEIRDKWDKLEEDILDQQKKQDAASQQWASYQ
DILNQTLSWINQMEANLAPEHSSWSSIQEIRPKLLKLKTTLQEILAHRRIIESLKDKSTS
MKDAPTYNQIKEGVDSVAKKYENLVTGYQKNIGQMEESLGVLQSFNDLVKDHQDGQKQIW
DALSGCSDLSGNKAALEERLVKLKDISNKLHQSEAVLDLLSKNILEKGKGLPAKAKEVME
RDINNLKYDHDLLKSKVNDIQNGLESSLKQWKDHEENLEVLLKWLSETEGALKNFSPRST
FPEKQEQLEKYQSLIVSQRQKETDFDNISDVSSELAQNSGDSRVSSNVQQIVSRYQTVQS
TTKDIVKKCQKAVEDHKNYLDKQKKCADLLAAATSRFEKLKALPENTPSELNDKSKGLKE
LLSEQPNVTLQVNTTMEMGEKLYPQTGIEGRDIVRKQLEGLQNALEILFDGVTSTERELQ
TKLTRWSSFNDTANQLATWLNTIEKEFSGELELKNTLDEKRALLNTYRGLLHDVSSHQPE
FVALKSQLEALPQKNKKAEDEFKKLSQRHSVVLKKAGDAVEKYEDIVNSHQRYSKAVMDL
QEWQDATHNTVELWGDGDLERVSLITNLERLKNLQKSLPDDKSKIEEVKVLAEKVLPGTA
DSGKVNIRSQVDSSQQEWESLLSTVKSTIEALENKLQQWSEFEQLKDQCLSWLRETDTKL
HAVDLKATVKEKRNQLEMLKKIQGEVRAKELEIDSATEKAQQLFKGRNSSASELGVKYQQ
LSAKIKDLTGRWQQYLNSHQEFDTKANECLQWLDKIRKKLSYCSDSNVVSQKDLEVKLET
IQGLLLCKEEGFSKIQNLVELGQTVLANTATPGHEEINNTLSKLQEEWSVLASKMVEIKT
NLDDSIHRWAGFLEQIHELKKTVESLENNYKDLLPFQSTMSEKRANLDKIKALEEKTRCE
KVEVDGLKEKAKEMLASGQQGQAAKQAKEVLNVFDDLADKIKKLLEERENQYKDHRLYKE
AHDDLLGWLNRAREKVPSMKQRSLSDKLALEQAISCLDSLLKKQAPGELLVEHLNNTGEV
VLSSTSPQGKELIKKEMEALTESFHGLFKDINSQKDQLEAMVSQWRAFKEEYEKLSDWLQ
QIDILVKAQKIALLSTVQEKQKQVAEVKDILEKLEKGNSQIVQFNETAKSLLQSHLDTYV
NNQLRHLNSRYQVQVNLAKDVLRKVETNYEQHKEYENHLKNAQDWIKNAKEIVRVSSEDS
NSTASKEELQARLKKIQDLLKNVEKGQNLMHLTVNCGEKVLRNTKSDGRDLINNQLKELQ
SEWDRLIRKLSTAKVQLETGLLQWADYSSSYSQLQQWITDREAKLQEVCEQKVVKAKKGQ
STAGLSNLGLGERKATLRQTDSIVQDIVSFEPVIQSVTSKAEDLLQAQPASEISTKYETL
SKQAKELYAKQKETVEQHQAFIDAGSDFVQWLRNAKERLGKCSDPTGDKVNLTNKAAQLT
VLNSELPEGQSKLEKALAVAAQACQIADPEDKEIIEEEVAVLQEELDIYLESLSRAKQLV
EAGIVRWNEYEDQYKEACNWLSQTESLVQGFNKLQDSLEEKKNVLEQFQGHLQTLFDWQK
EMDRLNMKAQVLLETCADTRVSNAVTQITSKYNALLSLAKEVMRRLELHYQEHQQHNSLY
QECQDWAERTRDKLNECSKPITSFSDAQSKLQTVKALRQSLETGQNKLRYTLELKEKVIL
NTEKTGAAKIQEDTENLKAELDRLFSDVDELRMKLGNQVSQLEDFKKNLKMLTDWLDETE
SKAKSTDIIMSDLGEKKALLERFKILKKDFNSYSDLVNKIKTKVEEDPAMADKEVEESLK
RFEKLKDWIGKKIKSLSNEVVEHEKYKQAYSDASEWVRKVRLEVQQYSDPHGEKEEAKKK
KSKLDEIVKTFPEGQSLVDKVFELKDKPLQKSSPEGQDNIKQELKQLKDDWDGLKTNSED
SLKILNKCITLWEEFDNTFKKMNDWLTNCKKKVKEEEKRKTNRKPEDLKVLQNLLDETNN
QKALSEELNDRCENLVDMSACTWVRDKTMQLQSEYTQILTTLQSLLSQLQKKLSDYTDFI
KARDELDNWLNWAHGTIKECSGVKEEGEIKEKLETIKTVSQRLTEGQTLLGKVQEVFAKA
VETAPGDEQDKLREEIARLRASWDQLNMDLNSTLADLKATLSRWEELKDNQNRFEKWLEV
TSQELKEPQNTKGELGEMKTAVERLKNIQGEIDQKKGDIFGLFKEAQKLCEGIKKPALLN
KTKDLTTKWQKLNDTCKNLRASVESEMNDYLSYQQHLQDVEKWLLQISFQLMAHNSLYIT
NREQTEEQISQHKNLLNEIAKYKNNLNDLTNKGQAQIKKYKDSAPNVQSTINKQLTNVQD
SYDSLLNTAEQIKNRLLESLAKFKEYEDTLDSISKNLDVLEPQVLKEIDISVDDIKSAQT
HLDNAKNLDNKLQLEKTRLAGAIQACEAASACVSRPSSPLEAAPPSTPEKELLLRARLED
LIDHLASRLVNLEQIIGDLEKWKKERDALYKWITEQSVVVNDWKSKPAKLRLESSKQDLN
TLNNLSSQIEAKRNKALTELPSLKDNEPDMEKLLSDLQKELMVVISEKESAQKVTEGYRK
KLADAHKWLDSIIKKLEDVEKGSGPQLDCYQKLGNVQELTNNINTKGNEMLENVKKLADQ
VAKLVNNLDSQQVEEQIKSLERRHSDVLKRIQRKTQSLEATKQGMEGIKQEVQQIRDWIK
LKADDLKTPSVLGYQSKPIKDKIQNLKTLMKEVDGKQVVIDLLKQRLNNLSNDLEPKEIA
QLESDLKSLTSEQSNLVASLKGELDKLDNAKNAREKFENNTDIINDWSKSKSEQVNKLGS
YVPLKSSDIQQQVVECKELIGDIKKFGETVLADQEKLGNSFNKDCSDEQKKKLQNVLSNT
KKNYNNILKKCDEKLGKYNELIANRNQFEDKLGKCEKWLEEAQIATANPIRSPKMAVVEE
QLNTYNKLNTEAKDVGDQIVEVCKDADLIMSKLNDADKLILQTQLNTVKDKHARLLGIIK
DRINSSNDILEKHRDAARKIKEIMEFMEKIQNAIKELNRPVGAKVEEVQAMLNSYDKILN
DLKDHKRELDNLKGKDVAGLDNALTQHDGLVKTVEDQIARLRQLLLLREQFGALIQQINT
FITKYTDIVKDVEKGDDSVQDKIKKYDDIIHKIQECDALLALATDKGQQIAADGSTNDRN
SITDMLGSLKQQLQQLKRSAERQREIHEKSLAAFGKLAQELDDVLDSLNNLESDVKGRPL
LKREPESVDEEVEKHKKLAATVQDCLNRIEKVQNSIKVNEGLPGALLEKISEGNGFLTTL
PPELDDRLKYLNNNKQLRIDYQGLKDKFYDWTKNAEKKIQKGSSGVDFDSVQKDLDNHKD
FFSCEPEILDLVSQIQSSGDNLWPSLSQNEQEELGRELQDVNQHLRNILNVAKSKRVQLE
SDCELWKEYLQNRDKILSILSRLKFADEDINNLAGLHKNVQKITHALNDINNQSSELELH
NEKSNEIIKRADNKSKDKFKKEMKDLNDEWKNTINDLEKRRDTLNNLAQNWERLETQIQN
FESFLTKANEKVKLLDVAVRSKSQEDEVRNTLTEIKTSLDTHNDDIKEIDSSFKPIKTFF
ESKNPVLIKDNENLIKTLKEKHKKLQEDVNNKLTKLNAEKEKVEKIKNQIQNYVKKLKEL
EKSVRDLYVYGEDQKKAEKSVNKLKDDIKKVVDDSKQFCNNTKEEYIKTQQFIPSDIAQE
ITALELYSESVNAAVDEKCREQLRAKNMRSDFANCVDEVKKWIRKCETVAKDKSSTPHAH
KEKIQEIQADVLSVTDRLQTAKKIGQTITELTKDKTEGDVVQKTLETLESELNQMKTLLN
QLRQEIGDSLDAWERFMTLHKLVMEWIIEKREFLQKPIHLENLPELKQKLDDYSLGVKSC
KTMGKNLSEMSKELELIRASYDVADLPDKLTKAEESKAEIEGEMMKRNALLSETNEEWEQ
CEKKMREVRSWLEKSRSSLESPTFKKRPIRDQLAAREKMLADVTIQKNKIAVSVEKLQVH
FRSGIGGDKTVVGAAKDIIKELDQILDAVKEQVANLEKCISQLDKYQQEIHSLRQEIVST
EQKLRTVLDPSFLAQHPEKARLEEQGKIFYLKKRQKKIELNENENENFIWHTCFMHH
Download sequence
Identical sequences E0VNW6
XP_002427810.1.24195 vb|PHUM347080-PA|EEB15072.1|Nesprin-1 121224.XP_002427810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]