SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002427847 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002427847
Domain Number 1 Region: 2703-2821
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-31
Family Cadherin 0.00059
Further Details:      
 
Domain Number 2 Region: 1323-1436
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-30
Family Cadherin 0.0009
Further Details:      
 
Domain Number 3 Region: 2283-2396
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-29
Family Cadherin 0.0011
Further Details:      
 
Domain Number 4 Region: 4006-4224
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.32e-29
Family Laminin G-like module 0.011
Further Details:      
 
Domain Number 5 Region: 1860-1963
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-28
Family Cadherin 0.00042
Further Details:      
 
Domain Number 6 Region: 1960-2082
Classification Level Classification E-value
Superfamily Cadherin-like 4e-28
Family Cadherin 0.0007
Further Details:      
 
Domain Number 7 Region: 1223-1335
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-27
Family Cadherin 0.00065
Further Details:      
 
Domain Number 8 Region: 3447-3558
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-27
Family Cadherin 0.00071
Further Details:      
 
Domain Number 9 Region: 3235-3337
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-27
Family Cadherin 0.00068
Further Details:      
 
Domain Number 10 Region: 2174-2289
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-27
Family Cadherin 0.00047
Further Details:      
 
Domain Number 11 Region: 1004-1114
Classification Level Classification E-value
Superfamily Cadherin-like 7.14e-27
Family Cadherin 0.0014
Further Details:      
 
Domain Number 12 Region: 481-585
Classification Level Classification E-value
Superfamily Cadherin-like 9.14e-27
Family Cadherin 0.0013
Further Details:      
 
Domain Number 13 Region: 3135-3235
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-26
Family Cadherin 0.0011
Further Details:      
 
Domain Number 14 Region: 587-694
Classification Level Classification E-value
Superfamily Cadherin-like 2e-26
Family Cadherin 0.0013
Further Details:      
 
Domain Number 15 Region: 2907-3037
Classification Level Classification E-value
Superfamily Cadherin-like 2e-26
Family Cadherin 0.0012
Further Details:      
 
Domain Number 16 Region: 1434-1545
Classification Level Classification E-value
Superfamily Cadherin-like 8.42e-25
Family Cadherin 0.00088
Further Details:      
 
Domain Number 17 Region: 2389-2493
Classification Level Classification E-value
Superfamily Cadherin-like 3e-24
Family Cadherin 0.0013
Further Details:      
 
Domain Number 18 Region: 140-253
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-23
Family Cadherin 0.0016
Further Details:      
 
Domain Number 19 Region: 2813-2919
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-23
Family Cadherin 0.001
Further Details:      
 
Domain Number 20 Region: 3551-3656
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-23
Family Cadherin 0.0015
Further Details:      
 
Domain Number 21 Region: 248-382
Classification Level Classification E-value
Superfamily Cadherin-like 8.57e-23
Family Cadherin 0.0012
Further Details:      
 
Domain Number 22 Region: 4250-4297,4337-4482
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.96e-23
Family Laminin G-like module 0.0046
Further Details:      
 
Domain Number 23 Region: 1760-1858
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-22
Family Cadherin 0.0019
Further Details:      
 
Domain Number 24 Region: 690-797
Classification Level Classification E-value
Superfamily Cadherin-like 8.28e-22
Family Cadherin 0.0011
Further Details:      
 
Domain Number 25 Region: 2071-2172
Classification Level Classification E-value
Superfamily Cadherin-like 1.34e-21
Family Cadherin 0.0013
Further Details:      
 
Domain Number 26 Region: 3339-3445
Classification Level Classification E-value
Superfamily Cadherin-like 1.37e-21
Family Cadherin 0.001
Further Details:      
 
Domain Number 27 Region: 384-481
Classification Level Classification E-value
Superfamily Cadherin-like 1.17e-20
Family Cadherin 0.0016
Further Details:      
 
Domain Number 28 Region: 900-1008
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-20
Family Cadherin 0.0031
Further Details:      
 
Domain Number 29 Region: 3024-3127
Classification Level Classification E-value
Superfamily Cadherin-like 5e-20
Family Cadherin 0.0012
Further Details:      
 
Domain Number 30 Region: 1114-1229
Classification Level Classification E-value
Superfamily Cadherin-like 1.36e-19
Family Cadherin 0.0019
Further Details:      
 
Domain Number 31 Region: 2489-2602
Classification Level Classification E-value
Superfamily Cadherin-like 6.42e-19
Family Cadherin 0.002
Further Details:      
 
Domain Number 32 Region: 1541-1643
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000528
Family Cadherin 0.002
Further Details:      
 
Domain Number 33 Region: 810-912
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000116
Family Cadherin 0.0051
Further Details:      
 
Domain Number 34 Region: 2611-2715
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000157
Family Cadherin 0.0036
Further Details:      
 
Domain Number 35 Region: 1653-1758
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000003
Family Cadherin 0.0024
Further Details:      
 
Domain Number 36 Region: 80-147
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000257
Family Cadherin 0.0085
Further Details:      
 
Domain Number 37 Region: 3951-3988
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000129
Family EGF-type module 0.011
Further Details:      
 
Domain Number 38 Region: 3911-3950
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000267
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  121224.XP_002427847
Domain Number - Region: 3891-3914
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00383
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002427847
Sequence length 5078
Comment (Pediculus humanus corporis)
Sequence
MLWVKKLAFLLSCQCLLIAAQGPGPGPGYKKSSQTPYSVLSGNSLAPAPMQSRAVDTRIS
FEIAEGLPSGTIVGTIPIKENFTYRFNEPPAEFSLDANTGVIRTTMVLDRESFRSDRFDL
VVLSSQPTYPIEVRIVVTDMNDNAPEFPEPSITVMFSESSAPGTRLLLDSAFDKDAGQNG
ELDYNIVGGNKDQKFRINITSNPSGEMSYLNLETTGNLDRETRAFYHLNISAKDGGDPPL
YGYLQVNVTILDVNDNPPMFDHSDYNVSLNESVPPGTSVLQVRATDNDAGDNAKITYNLE
DIGHQFSIDPETGVISTVEPLKCVRQQNCSEYSISLGSCPKSCVISVSAWDHGVPRQVGR
AYVTVNLIEVNTNDHDPIINFTYFLRPAKFATVDENAMNGTVVAAVTVVDEDEGLNGETT
VVIKAGNELNHFRLDSTPAVRVNGVLDREEISKYNLTIVATDKGTPPRSSSASLIILVND
VNDHEPVFEKSEYSVVLSELSPPGTYVAGITASDEDTGVNAQIYYAFVSGNDNNWFELNA
DSGLITTKTTIDREIQGSVELKISARDGGPSPKWAYTQLKVTVLDENDESPKFSQDQINV
TLLEDTPPNTLVAILTASDSDQGTNGSVAYFLDAEFSPKYSGPFALDSLTGQLTTKSYLD
REITPYYEIKVIAKDQGVPPRSSTAVVNLFVEDVNDNSPEFYPLKYFTIVSENIATGNKV
LQVFAHDLDEGKNSELKYSIESGHDDLFNINPKTGEIHVLSSLKQTPKGLFELVISVKDA
GGRKCSENAIVEIMKENHLISLEFNMLAGYEFKIVEDEGDKIGSEIGKIEIRERDGGHDI
KKENIRYYITDGDSTGNFFLNEETGVLTRIKVIDREEKQFYNLVCIARANLAYGKTWVNI
TVTDVNDNRPMFSREKDFVEVNENSPVGLEVYHSIAKDLDSGPNSRFKFNLTKNAQERFR
INEATGVIYLNRKINDDPGTLIPIEVTVTDFGKPPLMSKQTVVISIKDVNDHTPVFDHTS
YETSLLESTRVNKRFFRLVASDADLGLNGLVSYEISEGNFEGKFGIFPDGYLYVKSSLDR
EERDYYSLIVTARDSGEPSRSSTVSVVIHVIDENDNPPEFTNSTFTFHVLENEPPDSFVG
KLSATDRDIGRNAELIFSFANPQNEFIIDPKNGFVKTLIVFDREALIQTTGKGFISLEAV
VHDNGQIKLKDKAAVNVFIDDLNDNPPVFLTTPYKVQISEGSTLETQVLRVYATDIDEGV
NGEVYYSIAMGNEEQKFSIEQGTGQITLIKDLDRETTSRYVLTVIAEDGAVQNKLSVSTT
VVIDILDENDNAPEFVQTMFEISVPETTPVNTKLTQFKAIDMDIGINSEISFSIGAGNRR
DTFHIDPTSGTLYLHKLLDYEELNSYTLTIVASDGGNPRLSSTTLFNVTVEDSNDNSPVF
PNTALVRQILEGIPVNKAIVTVTAEDPDSGKNGEVMYSISSQEPETPGHERHFGINPKTG
VIYTLLPIDREAVDTFLLTVVATDQACPESSRRSAEKLVTVIVEDINDNAPIFASMNAAV
LPHQMTREGTLIMNVFARDLDSNTNGLVKYDLISGNAELFKLDINSGALTLRQSLVDPKP
IYHLAVKATDEAVQSERKSTEAYITLFLKGDGENEPKFLQENIQGSVYENESPGKSILTI
SAKLQGVDLEYFVTNVTGNGKQADCLFDVDAKSGVLTNAVALDRETGSEFYIVEVYAVGV
NTSRPHTSLTKVRVNVLDKNDSPPSFKNTKLNYSVSEDLPVGHVIATINAVDPDTIGKIT
YNLVGGGGENKFEIESSSGILKLNDSLDRETKDSYQLQVRANDGIQYTDAIVKIFVTDTN
DNPPVFSDNAYSFDVPENTIRGTRVGEIMATDEDEGINGQVSYQVISDWANDVFSLNSQS
GVFTLTTRLDYEEVQHYIFVVQAQDSGKPSLSSTLTVYFNVIDLNDNAPLFDPMSYNNEV
FENVTIGTNVVTVSATDLDSGQNGAIEYKIISGDENEDLAIANNGTIYTVKELDRETKSA
YNLVVTGTDLAEPPQQRLSSTVQVTIVLKDVNDMSPEFITPTKTSVSENIPLNTVVLAIK
AIDKDEGRNSYLEYSLYDPTKTFSVGTIDGLLRVVGKLDRETVANYSLEVVAKDKGDPPR
YTKQNIFVNVVDENDNSPMFDPKHYSASIAENASIGASVLQVSATDVDEGLNGKVRYSIF
SGDENRDFSISEDTGVVRVAKNLNFERKPRYLLTVRAEDSSNNDDDNIRYDTATMSIIVR
DINDNPPVFLDSPYYAYVMENTVPSPDGYFLTVRASDADSPQYNGQVRYFLKEGDAGLFR
INASTGDLYLSRPLDREKQSEYLLTLVAMDTGTPPLSGSGTVRVIVQDVNDHSPVFERQS
YVASIMENSPIGYFVTQPVATDQDDGLNAKIKYSFFGDKADRFHLEENTGVITTATILDR
EETSIYFLTYVAQDCSITEPKATAVNLTIIILDDNDNSPEFSSAEYSVSVPDNTSGDEFI
FGAKAHDDDIGKNSQIKYFLDGKDKDKFTIAPDTGVIKAAGKLSTASIDGSDKVYNIEIH
AEDGGEEPRTASAKLNVKLEPQEWFPKIIAPKENKFVLPENIETGKVISKLSAVSSKSDS
YDRIRYGIAGGNLKEAIKINSDSGEISVIGGKLDFETSPIYEVWVEAHYVDNSALRTVLQ
ITINVTDTNDNPPVIEKQIYSANIYEEEYPPLKVCTIKATDLDSEQNGEISYRLINDSDG
TFSIDEKNGDIFTEVKLDRESIASYTLTVEAFDHGNPQLTSTATVLVNVLDKNDNPPRFT
RLFSVNVTENAEIGSFVIRVTSSDQDIGENANATYSFTENPGNKFSLDPLSGNVTVAGPL
DRETQDEYLLKVAAFDGAWRSETPLTITIQDQNDNAPEFEHFDYSFNFPESQSSVIFVGQ
VIATDRDKHGANSVISYSLKHPSDIFTIDPASGEIFSKRPLRYKYTALEHSPENQYTLTV
LATDNGKPPMSSECLVTVNIIDSNNNPPKFTKSQYFSSLPKSADYEQKILQVKATDEQDF
GMNAEIDYSISGGNGSNYFNINEKTGWLTVSRANIPVKVLSRYVINVKATDRGVPPLSDE
AQVTLVVTGENLYSPVFPALSFQVIIPENDPVGSTILTIKATDDDDGPNGMVEYKISSGN
EDSKFHLNSTTGALKILKPLDYDTVSNYHLNVTATDLGFEPHQATAMVTISLTDVNDNPP
TFNQSVYKAYIPENSPPKTFIFQVQAHDIDSPKNAIIHYSIIRGTGKDVFTIDSKTGTIF
SKSRLDYEEKDEYSLEILAANPDSPMFGSTKVIVYVTGVNEFYPKFVTPVFHFEISESSE
VGTSVGTIQATDEDAGDDGKVYYLFVGSSNDKGFSIGSETGTILVSRRLDRETQNRVVLT
VVAKNAGGIRGNDTDEAQVVISIQDGNDPPEFLQQEYETRVPEDVRPGKIITTVKAIDKD
VRPLNNQFSYSIINGNSEKAFKIDPQTGAIETAAELDREKIPAYTLIIGAIDTGVPPQTG
TATVKIILEDVNDNEPFFDPPNIIGYVTENEPPNTSVLTLTATDPDLPPNGAPFNYFLTG
GKDKDFVFVEKTTGVIKTRKVIDREVNPQLEIMISVEDNGVPKLKSQHSVSIIVLDQNDS
PSTPRTVQVLVHYFNDELPLGKIADVHPNDADTTGDYHCKIINNPGTKTNFFIKNGCELT
VGKFTPNVKYHFNVTGNDGKHSDVMSTVSVEFFPFTNTTVDNSFTIRLEEMTSGKFFTHY
YDTFVESIKSAFQSTDYVHLFSVNEVDSGLELTMAIKNSKGYYLKDNSIENIMKKRDSIQ
RKIGATAIIGYKPCQKFTCENSGTCNDGISVLDGSRIIDSQILIFSSPVVSHDYFCRCPD
GFTGKRCDRQHDPCLPNPCRAGGTCRRQGHDFQCLCPVSREGKLCEHEKENACDGNPCRN
GGSCRQSPDGSSFFCLCRPGYRGNHCETTSDSCRPNPCFNGGICVSLKPGYRCSCPKARH
GRHCEKSTFGFNELSYMTFSSLDVTTNDISIIFATVKPNALLIYNYGIQTGGRSDFVAVE
LINGKAVFSYGGARSAITSVMVPRDNATLANGAWHKITATRNGRVVSLSVATCNDNGDAC
QECKTGDATCYADDIGPTGTLNFNNHPMLVGGLTSTDPVLERPGQIHSDDLVGCVHSISI
NGRALNLSNPIKSQNVDPVCGRSHSPCAGSSQTNEVVEIINPCGEGQCLDRWQSHLCVCS
GLVAANCHDVLEPITLSDGSFVEFKISEKHSRMQLLDNLYHGSTLWKNENQKYKRYAEGN
LSSGSIGNSVSGPFKSLSVVFRTVKSEGLVLYSATNEDFTSIEIKNGKILYISRLGTSGS
FVNMTVTELLVNDGQWHNLTLHSHNRGLKLLLDGKKVGEELDSAGVHDFLDPYLTTLSIG
GTKKKTFAASDPAPIGFEGCIANFTVNNEIQSFNGSGSIFSETIIYGKIVKGCAGPIGVG
ANTAPDPLSIGVTLVIVFFVTLLVAILVSFIVFHLRRQKKEKGEVPGGRGSLGISKQNGS
TTLVAGGEGMVGTTGEGVLSRGVHGEANVGYLSETADALRSHHLMAPELISKKYKEKEII
SSDAQRHSRPDIIEREVVGKSPLLREEHPSISSAQVSQNSHHHDNSEIPEHYDLENASSI
APSDIDIVYHYKGYRDGGMRKYKATPPHIPSSGGYHHKHAASQQQHRHSPHLTAGFLPPS
RDSSRSAIPPPPVSRVDSSPNVVNNLTSQNTSKLLSHQSTPLARLSPSSELSSQQPRILT
LSDISGKPLQSALLATTSSSGGVGKDILHSNSERSLNSPVMSQISGQSSTTSRKNQQQNG
SNAGNKSAPLGLTAEEIDRLNCHPRTSSLVSTLDAVSSSSEPPITRQNHHLNNANDIPDN
NSSTTTDESGNDSFTCSEIEYDNNSISGDKRSDILFSKLTEDEDDRSRSNNSGNASKPPL
PPPSYDGFDSSFRGSLSTLVASDDDLSTHMGGLLYRAPNGSPSSTAPLGWNYLLNWGPNF
ESLVGVFKDIAELPDAVNGRVQTLRLPNQSPKPNEEYV
Download sequence
Identical sequences E0VP03
vb|PHUM348500-PA|EEB15109.1|protocadherin-16 XP_002427847.1.24195 121224.XP_002427847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]