SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002428402 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002428402
Domain Number 1 Region: 35-220
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.14e-44
Family SPRY domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002428402
Sequence length 592
Comment (Pediculus humanus corporis)
Sequence
MAAISNGRNSSDIHNSIHCVEIDRLKFLYPMVNEDETPLPRSWSPKDKYNYIGLSQNNLR
VHYKGHGKTHKDAASVRATHPIPPACGLYYFEVKIVSKGRDGYMGIGLSAQGVNMNRLPG
WDKHSYGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCGVNLIDNTCFYTKNGHNLGVAFT
DLPPNLYPTVGLQTPGEVVDANFGQEPFMFDIEDMMRELRARTRLTIEDFPVSEVHGEWQ
AIIHKMISTYLVHHGYCATAEAFAHSTGQVFNEELASIKSRQRILKLVLAGRMGEAIETT
FRLYPGLLEHNQNLLFQLKCRQFVEMINGTDSEVCPNRLNRGHGNFSPSHTSNTPSRPAS
PIQTSVIQSTKTFNGNKARNRRLSTEQLNQQNNFSVNGNSAVDTVIRTNAYEENDIDMDN
TNVTERSSHYNTKVLSPETQNGVQNGSNHHFEWEDVKETEDMDVDSSNKRQVCGGSKPGI
ERMLEFGRELYNMSVRLGQEQGKDENNKKMLQDAFSLLAYSNPWNSPVGWQLEPLQRETV
CSSLNSAILESSQLPRRPPLEVALAHARELILLMSRSGLGSCAFSNVDEILH
Download sequence
Identical sequences E0VQK8
121224.XP_002428402 XP_002428402.1.24195 vb|PHUM378980-PA|EEB15664.1|Ran-binding

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]