SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002428701 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002428701
Domain Number 1 Region: 791-959
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000087
Family SPRY domain 0.024
Further Details:      
 
Domain Number 2 Region: 100-159
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000396
Family SPRY domain 0.025
Further Details:      
 
Domain Number 3 Region: 417-574
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000965
Family Glycosyl hydrolases family 16 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002428701
Sequence length 1705
Comment (Pediculus humanus corporis)
Sequence
MAAFHQKCGDRVILTNNQQTAVRNFSEFNNGIVLSSEPLLDNSLFQINSWSGSIEIGVIS
CNPDNLELPASATELKQNCWILSGTSILQDGKSSGDEAYGTDLEKLSEGDVVGVMRTDKG
ELKFFINGESQGVAARNIPEKVYAIVDLYGRCAQVSIIPSLPSSEMAIDYAISERQDESQ
TADLMNNLTLNVNIPQTDMQGKPILGDRLRFHARHGMLVKLSCNARTAERLKPLDEFNNG
VVMTHRPLKNDELFEIRIDRLVDKWSGSIEVGVTTHNPNKLEFPATMTNMRSGTTIMSGC
GILTNGKGTRREYGEFNLDELQEGDRIAMMRKSNGNLHYFINGLDQDVAAEKVPELVWGV
VDLYGMTVKVTIVDRDEREEQNLMTRRNTELRDYQISLRTCNFAEEDGGDRLAFHPKCGT
HAAVINNGKTVHRPNAMDDFNNGVALTNRPLKPNEIFEIRLDKMVTKWAGSIEIGVTTHS
PNDLEYPTTMTNVRSGTWMMTGNGVMHNGSTIIDEYGHNLDRLKIGDRVGASRKENGSLH
FYVNGVDQGVAAVNVPDCVYGVIDLYGQAAQATLIDVLDYSPDTDNSSVSNTTLYGDLRF
YHVHGRNARVFNNGLTAARTRTFGEFNHAIVITNRPLKEDEMFEIKIETLVDRWSGSIEA
GVTSIRPDEFDFPSTLTDMDHNTWMLSGSSVMKDGLTLKSGYPCDLDTLPIGTRIGLMRH
SDATLHYYINGVDQGSACENIPLGVHGVIDLYGQCAQVSIINSSEKVSNPCANTMVNSEY
ALNAPQIPLEVIHSLSTCSGKNIVLENCNTVAYRNKNYAHGLVFSAQPLENDEYFEVSLM
ETSKQWSGSLQIGVSTITLSDSFQPANLPPVMSGISYDTWYLSGSDVKKNHSTLKTNYCP
SLEWLTPGHKVGVRRTNDGCLKFTLDGNDLGVAATNVPKKIYAVVDVFGSATKISVTSMK
RSGLFQSINDSSVTSNQSAKLQDSVDTLGDAIPTSSKLEYGYDSGGGGETGTLSSYDIHP
NLTINQGQGDESADTNFALSEYHGRNIKLLERKLGAKRVASYNQAVVISQKPLQKGHPYQ
FRIDKINPVWSCGLAFGVTSLPPNSVQSPINALCLKEHSWIVYKDFIFKNGKKIREGYGI
KNFIFSVGTMIKILVDNESKLRIFINDCDLGVVASDLPNPVYAVIDLNGRCEEISIVSEK
IQIRGSELQDCQKEKADSEIQEKYPEEESIEQCGKNQKMDVKRRHSKEMTKTEQKLSSSD
SYNSGIQQISSHAASCSFQTDTDNFNTQIQQLTIDLKSDLEKSLSVEDGESTTLMTSSDT
YNTELQLLSAQGNSQTNLDDLNIQIQQLTTSNSGHDISSNCIQNISRSQSQPFLNKNLKE
NFTKEEKLDKKENKDQIEFESSEVSGSGIETGENDDEEIENSDVNGDEKNENESSSTSYS
RNSLKNNMKIKRQQQQQQQQQQQQHQQPVGGSKLINLSSQNLRNSQSTIERRRHCDYFTL
CLRFKNTLGLPDGFFSKEPGTCYCNNCYQVQAVEETYKMKGDPPTEYSIPMGWAKFPLKK
HPSATEKIDTWQVAFYGTRPDAIRRILDHGELVLPCLLGMERTRVKAKEDETDSSHIVFS
PSIKYAACDYFVTKFRFYDSRTKNKTEATLAFQILVQPGSYKVGPPSVDVSKEIPDTRFE
RDATEWVTKERGATTLSALLIKLEG
Download sequence
Identical sequences E0VRF7
vb|PHUM397400-PA|EEB15963.1|neuralized XP_002428701.1.24195 121224.XP_002428701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]