SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002428850 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002428850
Domain Number 1 Region: 26-207
Classification Level Classification E-value
Superfamily vWA-like 4.03e-35
Family Integrin A (or I) domain 0.0024
Further Details:      
 
Domain Number 2 Region: 1310-1498
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.68e-33
Family Pentraxin (pentaxin) 0.00075
Further Details:      
 
Domain Number 3 Region: 1576-1634
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.81e-17
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 4 Region: 325-387
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000195
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 5 Region: 1662-1712
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000001
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 6 Region: 963-1081
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000168
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 7 Region: 388-448
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000082
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 8 Region: 1767-1833
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000931
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 9 Region: 1826-1896
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000598
Family Complement control module/SCR domain 0.0034
Further Details:      
 
Domain Number 10 Region: 1167-1208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000649
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 11 Region: 440-504
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000987
Family Complement control module/SCR domain 0.0036
Further Details:      
 
Domain Number 12 Region: 1886-1945
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000459
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 13 Region: 1508-1581
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000195
Family Complement control module/SCR domain 0.004
Further Details:      
 
Domain Number 14 Region: 1158-1301
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000022
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 15 Region: 1096-1132
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000329
Family EGF-type module 0.018
Further Details:      
 
Weak hits

Sequence:  121224.XP_002428850
Domain Number - Region: 1700-1760
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000695
Family Complement control module/SCR domain 0.0049
Further Details:      
 
Domain Number - Region: 224-376
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00126
Family Growth factor receptor domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002428850
Sequence length 1945
Comment (Pediculus humanus corporis)
Sequence
MTNSKNFSKYPKTSVLADIFRKKIQNLKTHKEVELIILVDGSYSVGPKNFLSEMKYIQKV
ISDVEVGPKAFRLGVIIYSTQAVDHLSVTDELDLEKCSLLHVQIPKIKYPGKNTNTKEAL
EKAEKILTRARKGAVKIIFLITDGFSNMGNPLPMAQILKDQDTIIYTFGIINGNARELLK
ISSQPIEEHAYLFTSFDEFEKFARRALHEDLSPGTYAPVKNSKMCNYLCTNSSDEGCCSD
GAICTCGLISGHFSCLCPPGYYGSGLKGEGCKLCPKGSYSQGLFPGDILSCATCPDKYHT
TINFPASNKSFCVCANGTEPDGDKCKIVSCPTLSPPSNGYFVKKNCSNVINAACGVRCHM
GYVLTGTSVRICQKNGTWSGIEPECKAKKCNPLKPVPSSQIIFDYLVGTKCSYSCLAGHS
MIGSKTRDCLPMLKWSGLKPTCKKIQCSSLPQLPSGSIKPQNCTSKGIKHSFGKICKFYC
NPGYELKGPKLTNCTGKHGTWSEKNNPNRCVDVEPPEIDCPKNHSTKTDDNMYFATLTMT
LPNTTDNSGKKPVIWSKPPFEENSTLRFSIGDSEVQIYSVDESGNYGFCSFFVKVKDDEK
PKILECQSPPIFFISELPYNFTEISWKEPVFDDNSGIPVSIVRTPDNFVIKKGINSINYT
AIDTSGNNETCSINVTILDNPCSEIPTDTDTLWNCSINDKKITTCKLSCSSGYGFSSNNI
PDDVIDLNCTYFGRKAYWTPKIYIDDGFFPECTEMELPEIEIEVPDSFCDDLNMLSNDLN
NETLSLSTTLCDEDNWNETSDEYDDDDDDGFTSNENTFFDYDNDSFIFSKTERDKNINSI
LANLYKVPVDRYEELENLISSGNEKEKIKDEENKFEKNPNKSQKNLLYSTEDEINKKKLT
IVQEETHSLKENDNDDDDDEKIREKRKVKRRRKKLKISLKGAIGTIENLYGKSGKSKIKT
KIFCKNGSLPKNNFCVKCPKGTFHNVDNSKCDPCPIGHYQETEGQTSCKSCPRGFLTRRI
RRKHVKQCLKICPPGSFGNITRETNLSLSPCTMCPIGFYQVFEGQSRCESCPRNLTTLRK
GSTNEKFCVKASEFDDACTNINCRNGGHCFVTDGFPHCQCLPGFIGSFCERTFDPCGSDP
CYNGGQCLLLDFINYKCQCSEGFEGEYCEKNVDNCFSNPCNNRGECTNLINDFKCDCHSG
FTGKTCNESLKLCQELEPCLNSGTCIDVNETYECVCQKGFYGRHCDVIYDCDYENCTSEI
PKIIPDPCDNYTCLNNAQCVSDRFGQPTCTCISGFRGNNCDEEINPNVILNFPKYGVTEY
LMSDFPKNDLTEISVCVWIKTKDIFNYGTLFSYATLENDNAFTLTDYSGVVLYVDGNYVV
TDLQANDGFWHFICVTWQSLNGQWEVFLDGVLFSNGTGLASNNKIKGGGKLVVGQEQDSL
GGGFNDVESFAGQLTNFDVWKKLLTPAEIEILYGACDPGFGNFISWINLLQNINGDITEE
ESIFCKTCDSNLEIYNGEITYDFSKHGKVANYTCNDGFIIKFDTDNNYNDEKITFYQRKC
MKYGGWQRKEPKCGRISCGFPGYFLRGKISGGSYLYGDEITYSCSPGYTLEGNNIRICLS
NGTWSGKPPTCSGYSTECEKLMAPRYGSMFVYFNNTKPYSSSTVAIGDRVEFTCDEGYAI
KGFPILTCIEGGVWDREPATCEKISCRIPIEISDVLPPTLDFNSKFYYGNIITITCPSGS
TKNISCGHLGNWNYTDDVCKSFCEKKPPRSIRNGYFVEENPKTFYNEDEILKIKCKAGFY
LQGDNYFKCSENGTWIQNQKTVCLPINCGPPPRPPPAYQIVHEEGYNYKNKIYLRCSKGY
ISAGEIFMRCQANGRYSRVTNYCNKISCGAPILPDNYHIASHNSDYTYGSKISIYCTKRI
FSNQNFNNIIECQSDGKWSFVPKCE
Download sequence
Identical sequences E0VRV6
121224.XP_002428850 vb|PHUM405150-PA|EEB16112.1|conserved XP_002428850.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]