SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002429060 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002429060
Domain Number 1 Region: 102-170
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.48e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 
Domain Number 2 Region: 332-384
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000167
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number 3 Region: 24-72
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000146
Family Eukaryotic type KH-domain (KH-domain type I) 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002429060
Sequence length 389
Comment (Pediculus humanus corporis)
Sequence
MAVVVAVVVTITSFSLLKEKTRIRGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVA
KAKREILSAAEHFSQIRASRKTNLGGLLGGLSPPGPPANIPGQVTIQVRVPYRVVGLVVG
PKGATIKRIQQQTHTYIVTPSRDKEPVFEVSGLPENVQVAKREIEAHIAMRTGAGTLNGT
NMADLLGAPLIEDNSELLASLYKTGLGSLFSCLEPSDTNSTTLNSDALNMFHPTSLTSSA
SSGAFSSSGSLSSNSSSSSNGGRIGDLVSIWNSSLERDEGIGESPGFETTTTSSNIWSFP
SSASTTGITTRPSPTASASPTDSLASITGMSLGTKRDCLVCAEKEINAALVPCGHNLFCL
DCATRLCEGTEPACPICSRTVCQAIRILS
Download sequence
Identical sequences E0VSG6
vb|PHUM418100-PA|EEB16322.1|conserved 121224.XP_002429060 XP_002429060.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]