SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002429374 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002429374
Domain Number 1 Region: 13-214
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.06e-33
Family Laminin G-like module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002429374
Sequence length 1727
Comment (Pediculus humanus corporis)
Sequence
MAERNKKKKKHGVVDLLFETKAHEEPLGVSQIEGLCLSRPGNDTEDKAYRLSERALLTVN
SIQIFPKGFPTDFSIILVVKPDPDTSVSTLFTVYSDTGDDQLAVSLGKDVILFLQDEETK
PQTQNVISFGVGINDGKWHRLGFSVKGDAATLILDCEKQITKVLNREPFSKISVAGIFLI
GQQLLDEGFFKGDLQTLMISSTPDAAYEICTEYCPPCDQPFKYVQPKLNLPEVIHGKQQG
KKKKKHFQALESQYTSLDGNLIRINEDFDEDDYEEGNDDDEDENQTKENLSFVVPDINII
SVTRQPSYDNNTEPFESENVLTYNSKQPFEVGVEAHYVRGPPGPRGYPGIPGLPGLPGPK
GERGRDGMVGNIGIPGPPGHVFMIPLSSSSTDKGPDSQAEHMRHLLSQHMVAMRGVDGPM
GITGVPGPQGPPGPEGLKGEPGEVGEPGPRGLRGMMGPPGREGRRGRPGRDGERGMTGPP
GTKGEQGLPGLPGLPGEKGERGLSGAPGQPGMTGHEGMQGDDGPPGLPGLPGELGPRGFP
GPRGFPGLPGSPGVPGGEGPPGAKGASGPPGQPGNPGQPGPPGAIGPPGPQGPLGPPGLP
GSPGKSGLPGLPGAEGAPGHPGSQGNSGPKGDTGPVGPQGPVGFPGTRGVKGDEGKRGPS
GEKGEKGDRGPDGEKGDLGMKGDRGVPGPAGATGLEGPEGPKGFEGPRGETGPPGPQGEK
GKIGSPGFAGYPGAPGEKGDKGTEGRIGQPGEKGDRGNQGQPGERGETGPRGFRGARGRR
GSEGTPGPKGDTGQPGPPGPQGERGPQGPDGARGFPGPQGAPGSNGKDGPPGGPGERGAP
GEPGPQGPSGAPGVVGSPGPAGEPGPIGEPGAPGHPGLPGEPGDPGEMGKEGPTGPAGPV
GKPGPPGPPGAPGFPGERGHPGLPGTSGLKGEMGPAGPMGPTGDKGQQGEPGKDGPPGPE
GRQGSPGSHGAPGTKGDRGEPGIAGATGRDGLPGLRGLPGPPGPIGPPGEDGDKGDVGAP
GEKGFKGAKGEMGPPGSQGTQGIRGEPGALGLPGEKGPPGEMGRQGAKGEDGPPGVSGPP
GAPGPQGLPGPPGVKGEIGDVGAKGPLGPAGLPGEQGPRGTKGGEGPTGPPGPEGLQGPK
GEPGNPGLPGPPGLDGKHGEVGPPGPKGEEGKSGPQGSPGPRGPAGVEGAKGNPGPPGFP
GPAGEPGIPGPKGEAGLDGSEGKPGDTGPPGEAGLPGKPGEPGPPGKVGPEGPAGIQGSP
GPPGEKGDGGPVGPMGPQGLIGPQGLPGLRGPPGPVGSPGNAGDVGPPGKTGAEGPPGKN
GERGLKGMKGDRGRRGSKGHRGEMGLPGIKGDMGEKGERGLLGMQGVEGKKGEIGPPGPP
GPKGNDGPPGMPGVEGPPGAKGSQGVAGMKGEPGKPGLPGPPGPPGEFPLLPPELLFQTG
TETESHFKADSRRRRDIETELLELEELIKEEERATATSTSKPGTNTNKKSKQNNEDNGKF
LDMYSSIYTMRQDLERIRKPLGTRDNPVRTCKDLFYGHPHFKDDWYWIDPNLGMTDDAVY
VFCNITGQGETCVFPDIHSRQMPNIPWRKEGEKTDWYSNLRGGFRITYETIGVVQMTFLR
LLSQEAYQNFTYTCINAAAWHNQKGDNYNFSIRLLGENEVEFGYNEIKPIILADGCKTRK
SKTETIFQIKTKNLEQLPIIDFYPVDYGLPNQAFGFHVGPRLVDMHT
Download sequence
Identical sequences E0VTD0
121224.XP_002429374 XP_002429374.1.24195 vb|PHUM430790-PA|EEB16636.1|collagen

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]