SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002429517 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002429517
Domain Number 1 Region: 233-448
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.45e-24
Family Clostridium neurotoxins, the second last domain 0.054
Further Details:      
 
Domain Number 2 Region: 55-154
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000443
Family Cadherin 0.0023
Further Details:      
 
Weak hits

Sequence:  121224.XP_002429517
Domain Number - Region: 10-62
Classification Level Classification E-value
Superfamily Cadherin-like 0.0003
Family Cadherin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002429517
Sequence length 864
Comment (Pediculus humanus corporis)
Sequence
MFARILLKDNGEAELRAKKSLNCEKRKNYKFDIAAVGCSGEISDNATVHISVVDINEYPP
TFIEPSYVKQVDEGRLYNEIVRVEATDRDCTPKFGDVCKYEILTSDQPFTIDNEGAIRNT
EPLDYERSHNHILSVVAYDCGMRQSLPVMVTIKVNRVCKLGWKGIPERIDYAPGTGREDL
LPDASLELCEIPCTVSKVLTRISLATSHIGKGCDRDTYSVQSQRKLCGANKKSVDLLPSP
GLGTEWTKPLPTDEGRESDEIFEFDGSTTAVAIPKDVVDHNLSTVFTISAWLKHKHIPNQ
EKHVKEHVVCSADDHKMNRHHFAVFIRNCRLILLLRRDFSEGDLNIFRPAEWRWKIPQVC
DNEWHHYAISVKFPQVDLYLDGQLFKTEKKNPEIIDDWPLHLTKGINTTLTVGACWQGKG
GRHRPPTITNFNVEYFLGYIAGLSILLGENEKSEVLSCLHKCKETLEVPSVKLLEPGMEL
ITNSDLTELSIEGNNKTNLETLIRKVGYINSREFPTPGRRNIHIMTQVTCDKNHVVKIPP
VESYVMVLQPQTPTIEINGTSNIAREYEDFREGVRVFTDIHITVGTTSKHEKVWRQGEPM
SVIEKKLDSCTVSVYPSLNPDHETLTLPENMVSQLGITAKVNKDGAVLRHIQYTNRKPAY
YLNRVFKLICTELNGRFTSNEYVQTLTVIHPRVPAATTKPPANEKYIHDRTQAVVAGGSE
SIPSFFTFSSHAVTIIIVVCVGFLLFMIVLGVIRIRAAHHQNTVQEISDTEMAWDDSALT
ITVNPMEVSLGRRIRDSFFLCPTLTNCVFFFFFFFWHRKWTAETTDLATRVGKCWITTTI
SVPRIRNVAWIQATTRVLRLLARV
Download sequence
Identical sequences E0VTS3
vb|PHUM437570-PA|EEB16779.1|Calsyntenin-1 XP_002429517.1.24195 121224.XP_002429517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]