SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002429585 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002429585
Domain Number 1 Region: 219-288
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000617
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000997
Further Details:      
 
Domain Number 2 Region: 284-362
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000395
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 
Weak hits

Sequence:  121224.XP_002429585
Domain Number - Region: 57-116
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0467
Family Chromo domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002429585
Sequence length 492
Comment (Pediculus humanus corporis)
Sequence
MEELAVEVFGENGACYKAYVTDVFDNEVSVAFENDWQPESKFPFSQVRLPPAPVIGKVEF
VEDQKVEVYSRANEAEACGWWTATIKMSKGEIYVVEYKDGESTYTEIVAIERLRPKNLNS
TIDKNTFYKFEIEVPEELREYAKMDNAHKELQKVIGASICRYVPERGVLSVISRSENSKK
LAGMLQEMHFRNLGQKLLLLKRTEEAARQLETTKLHTIGGYTDEFSVREDLMGLAIGAHG
TNIQQARKVDGITNIELEENSCTFKIYGETNDAVKKARGMLEYSEESIKVPRVLVGKVIG
KNGRIIQEIVDKSGVVRVKIEGDNEPQPTIPREEGQVPFVFVGTVESISNAKVLLEYHLA
HLRDVEALRQEKQDIDQQLRSIHGTNMGSVQNFPIQRRNDRGYNSDMDSGSGRGRGGQMR
GRGPSRGRGGPGGRHSGESRFNSGNPSNVPDYFNNVDNKKGPQSGRGRGGSNNGRTGRGS
GRGKGGGGSDLK
Download sequence
Identical sequences E0VTZ1
vb|PHUM440700-PA|EEB16847.1|conserved XP_002429585.1.24195 121224.XP_002429585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]