SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002429612 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002429612
Domain Number 1 Region: 5-104
Classification Level Classification E-value
Superfamily POZ domain 2.88e-33
Family Tetramerization domain of potassium channels 0.00000226
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002429612
Sequence length 114
Comment (Pediculus humanus corporis)
Sequence
MDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQV
LNYYRTGKLHYPMDVCGPLFEEELEFWGLDANQVEPCCWMTYTQGKGKKEKFVI
Download sequence
Identical sequences E0VU18
XP_002429612.1.24195 vb|PHUM442470-PA|EEB16874.1|voltage-gated 121224.XP_002429612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]