SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002429942 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002429942
Domain Number 1 Region: 32-256
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.35e-72
Family Lectin leg-like 0.0000288
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002429942
Sequence length 329
Comment (Pediculus humanus corporis)
Sequence
MRLFLIENNYLYLLIAALCTVSKGEWNTKDFMKREHSLIKPYQATGTSIPYWDILGNTIV
TTNYVRLTPDSQSKRGAVWNAVPCKVRNWELQVHFKVHGSGKDLYGDGLAIWYAQSRMIP
GSVFGNMDYFQGLAIILDTYSNHNGPHQHQHPYISGMINNGSLHYDHDRDGTHTQIAGCE
AKFRNVDYDTHIAIRYERDVLTVSTDFENKAAWKVCFQSKGIILPTGYYFGISAATGDLS
DNHDLLSVRLFELDVPQDGKAFEDRSHVLPSAVFFEPPRGEIEDPKPSSWSGIKLFLVMM
LGSITLIAIVVIGIMYYQKQQENSRKRFY
Download sequence
Identical sequences E0VUZ8
121224.XP_002429942 XP_002429942.1.24195 vb|PHUM457100-PA|EEB17204.1|Vesicular

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]