SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002429966 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002429966
Domain Number 1 Region: 69-141
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.9e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0009
Further Details:      
 
Domain Number 2 Region: 156-240
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000011
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002429966
Sequence length 319
Comment (Pediculus humanus corporis)
Sequence
MWPAQQIMAADSGMETCTSPEITDSRKRPLDGDIENGGTKRSHYGGVTYILCESKFLFLF
LGGDGIVYHLKILVPCIAAGAIIGKGGETIAQLQKDTGARMKMSKANDFYPCTTERVCLV
TGSVEAIMAVMSFIMDKIKEKPDLTSKAINTSDTESKLSADRSKQVKILIPNSTAGMIIG
KGGNYIKQMKEESGSYIQLSQKSNDASLQLQERCVTIIGEMENNKKAILKLLAKVVEDPQ
SGSCLNVSYADIPGPVANFNPTGSPYANPASPGYSTASLSSAVAPMLVNGAGLTFFLNFT
SPVTTGNHTLTTQLMESVK
Download sequence
Identical sequences E0VV22
XP_002429966.1.24195 vb|PHUM457910-PA|EEB17228.1|polyrC 121224.XP_002429966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]