SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002430233 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002430233
Domain Number 1 Region: 9-167
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.84e-47
Family Calponin-homology domain, CH-domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002430233
Sequence length 184
Comment (Pediculus humanus corporis)
Sequence
MSLERAVRAKIASKRNPEQDREAQEWIEQVLGEKFPPGVLYEDHIKDGQVLCKLINKLQP
GSVPKINSTGGQFKMMENINNFQKAIKAYGVPDLDVFQTVDLWEKKDIAQVTCTLFALGR
ATYKHPEWSGPYLGPKPSEENKREFTEEQLRAGETIIGLQAGQNKGATQAGQNIGAGRKI
LLGK
Download sequence
Identical sequences E0VVT9
vb|PHUM467600-PA|EEB17495.1|Muscle-specific XP_002430233.1.24195 121224.XP_002430233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]