SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002430757 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002430757
Domain Number 1 Region: 1589-1747
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.85e-17
Family Laminin G-like module 0.027
Further Details:      
 
Domain Number 2 Region: 763-781,1349-1513
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000206
Family Laminin G-like module 0.028
Further Details:      
 
Domain Number 3 Region: 988-1069
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000338
Family I set domains 0.03
Further Details:      
 
Domain Number 4 Region: 1073-1159
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000364
Family I set domains 0.011
Further Details:      
 
Domain Number 5 Region: 1164-1254
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000698
Family I set domains 0.012
Further Details:      
 
Domain Number 6 Region: 121-187
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000535
Family I set domains 0.029
Further Details:      
 
Domain Number 7 Region: 903-981
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000015
Family I set domains 0.014
Further Details:      
 
Domain Number 8 Region: 62-96
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000483
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 9 Region: 677-713
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000737
Family EGF-type module 0.074
Further Details:      
 
Domain Number 10 Region: 1246-1338
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000861
Family I set domains 0.055
Further Details:      
 
Domain Number 11 Region: 403-442
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000921
Family EGF-type module 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002430757
Sequence length 1797
Comment (Pediculus humanus corporis)
Sequence
MNIKENKTETTTSVVTTFSKNYTTNLFTLELTTPIPSRIINFPACAAKNESENGYFCQDH
VSIFECNDGQKVNKSLRCNRKKDCQDGSDEFDCEFWPPKITLLPEHRKELLCQLDDSDNF
ETLLLECEFVGFPEPLIKWKKYEGHVPSKCQQVSLEGRGMLLCPNFQQADQGAYSCVAEN
SVGVSESQPKSLVICKNYISCNGFKIKSEDNIEHCLDCFCSGKTTNCQNIKSKPTVVTIP
FPSAVTDIRVENNGKIVNTVGTNVTKDKEQKIKYYVLTKEELNENSFLKSYGRSMRIPRY
SKKINYMPDAPDIIIEGSKTSLFYTFNIISPSSNTVDVRFWPGNWHHLNRTTATRKDLMS
VLSGINRILFRCEYSKGIYEKWTKNTNIYLESSFIEESNASVSYVEKCICPEGYMGLSCE
SCAQGYERKIENDDFICRKIQCDSKNGFFLSGSQCVKSPCSINGSLSLFPDFNGKCNCKE
NYTGDFCNNTVSCQPGYYNVDKFKTCVKCWCSGVTDKCNGSTLYRTEISSFSLGGYNSSN
GRNFWLLPSIFSGNRLGSYGGHIKYSLKYSHEMPKQNSLLSVEILTVNETTLSFTHSNID
KSTREKEKTWFVPLLEGHWKKADKTFANRSEFLLALTKIKAIYIESPYHISSGKVNLTWV
RMSDAQLLGTGSELASDVEQCFCPPGYSGLSCENCAQGYYKKKNTNLCLKCECDNCDPVE
GCLSCPKGFYQENSKKEKKPICKPCECNNREEKCGKDDYNNTYCICKPGFTGLQCENEVV
SSQNSTHLTVKISPNKITSDVGGGSVSFNCSYDSGEKMKISYKKIFLDRTEGPFLGTLLS
SNQKTNDYNGFINFNVEFSEDLIQVECLVHNVKGMEVGKVLAIVENTATFQPVKITNCYS
TVTHVKETKSKDFICQVTGYPQPITTWFAKKENGTRQKVESTGGVYSIEAVTLQDNGTIY
TCEAENSIGDKDVCSVLLIVEKNCDLVHIIPKWQEVEEGDDIILQCKTTANSSVSWSRPN
KILPFFRTFEKNGNLNITNSKIDDSGNYTCKALSSDGRRIEQSAWVNVKEKLTPPVISID
KNDTIILEDGDFEVKCSATGKPAPSVTWMKISGKIDNNVKINNGILKIKGATLGNSGIYQ
CEANTTAGEDVGRVFVEVKETKIPPKLKIVPSSLIPIEGERAFLECVVLEGKPKPTLYWL
KEINGEFKKYKDGEKLEFLNISRYDGGIYQCKGQNSVGRDEAFSEINVMFVPEITLSETH
IEVYENEEISVRCSAIGNPLPKLMWKNQLKSYKRNIKDNDVLANMYLNPPEITVKLKAFS
DLIGLICVAKNEAGESEKEVLIVDGFVPKFTQELNSFLVLPTTLSSKKKIVYEISFETKK
NDGLLFKDENDVFVLYIHDKKVSILLHLDYEKRHHFNSTINLNHNVWYTIMVEMTLKTVK
LIIYDSNSAVLEEKIEHFNNFRDVIYTSLFNNFYVGEIPSLDGCISRLVIDDKVFSLIKE
GSYSTNVNLCGKCSERLNPCRNIGKCLDAPTQLGFVCLCPEAQRGEKDSCPPSCYGRGCN
SQRDLCNMLSPCKRKDLNFCSNKISSLSCSCSLGYSGLTCEKEEQSSFCVGGDGYVKLPS
KYLYRFSLAEPETIEIHFTTTKSNGLLLWLIDGKVEYTYKNQGIKLQVQTRERLSFDKNH
TLIAKRTNESVVLHVDSITYTNYTKFTTNRVVGDIYLGAPSNFLPYEDRLWFMNNYGLSG
CINFVSFGLKKQKINFKENILESLNTYQYKPELATNVIEIYNYDRSESDSDDHFEYE
Download sequence
Identical sequences E0VXB3
XP_002430757.1.24195 121224.XP_002430757 vb|PHUM497960-PA|EEB18019.1|cell

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]