SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002430784 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002430784
Domain Number 1 Region: 1181-1365
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.82e-36
Family Laminin G-like module 0.00063
Further Details:      
 
Domain Number 2 Region: 689-708,942-1100
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-31
Family Laminin G-like module 0.00083
Further Details:      
 
Domain Number 3 Region: 1401-1602
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-31
Family Laminin G-like module 0.00018
Further Details:      
 
Domain Number 4 Region: 114-181
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 9.56e-16
Family Ovomucoid domain III-like 0.006
Further Details:      
 
Domain Number 5 Region: 261-327
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000018
Family Ovomucoid domain III-like 0.0082
Further Details:      
 
Domain Number 6 Region: 188-255
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000929
Family Ovomucoid domain III-like 0.0042
Further Details:      
 
Domain Number 7 Region: 38-112
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000347
Family Ovomucoid domain III-like 0.0033
Further Details:      
 
Domain Number 8 Region: 404-468
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000208
Family Ovomucoid domain III-like 0.0061
Further Details:      
 
Domain Number 9 Region: 346-398
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000222
Family Ovomucoid domain III-like 0.0055
Further Details:      
 
Domain Number 10 Region: 530-583
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000194
Family Ovomucoid domain III-like 0.017
Further Details:      
 
Domain Number 11 Region: 1119-1165
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000536
Family EGF-type module 0.013
Further Details:      
 
Domain Number 12 Region: 724-760
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000536
Family Laminin-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002430784
Sequence length 1614
Comment (Pediculus humanus corporis)
Sequence
MMMNEKKTRIIIIIIILLNISKIALSCYVFPTEQENPCKDKKCQYGARCVPSLDGKSSEC
KCPENCPNLGDHVGSRPVCGSDGLDYRDSCELKRSACLTNTEISIKYQGKCDPCDNIQCP
EPEICQLDEDRQPECRCGESCSLEFTPVCGSDGKTYSNECSLRQESCRTRKNLRIIYRGK
CSSGFNPCSSLKCINGEECVINKYGIARCECPTDCEPIVRPVCGNNSKTYDNECELRKSG
CLSKTKLETSYAGICGGEGPCSGHFCTNGALCVERGGKPYCECPTCPSEFDPVCGSDGIS
YGNECKLRLEACQHRRDISVLYPGLCNGCENKRCEFYGICESDGFGETNCICPSNCPEGL
QGLSVCGSDGKTYNSECDLRQHSCKTKQLISIAYKGDCDLCQGVKCKFGSRCVAGDCICP
INCSYTDSSELVCASNMVTYANECEMQKASCEQPEHLPPLSVFFYGSCKEKFTLPTTTTS
ITPIRTNVIDTGDRDKLMRNKTYTISEREKEVCKDIHCDYEATCELGPDNFPRCTCKFDC
ENVVGGGKMVCASDLRIYPSLCVMKMEGCQRQEELRLRPLELCEGMEVKPCNGEPPLIDS
VTNKEYDCGSGPSRQDCPSGSYCHHTKHFAKCCKKDLNTLFDNCSDSWYGCCLDGVTIAQ
GPDNTGCPSLCGCNRLGSFDDTCDEDTGQCNCRPGVGGLKCDRCEPGFWGLPKISEGQNG
CQPCSCSQYGSVRDDCEQMTGRCVCKNGVQGQKCTICTDANKFLGPAGCVYGNYDTDNAQ
KNQNVEERSIKTEQILSDTGTEWPLKRSTSVKYTESESISSPLYKSTRHLKFPDHRYMYN
GEDTSQLTSASLYHLSDTSHAVPWHTEGYNVGIYRPTPATITITALLGDLCEISADCGVP
HSECIKGSCLCPDGYSETPNRQDCISDNFNPTPYHKAYEIPSFDGRSYLQLKRLKAYNKL
TVEIEFKSYANDGILLYSQQKPDGTGDFLSLAIVNGYVEFRYNLGNGAVVISSLEKIELK
RFHKITAKRYHRDGILKLDDYEDVAGQSQGTLKSLDLVEHAYVGYVPTNHSRVYENIGTN
RGLTGCIRKLKIGRHIVEMNEERDQLVEKIVGVMECGENPCSNLPCNNSGTCFAIDSEKY
VCNCREDYTGQHCETWLNPCLSEPCGFGSSCDPHLSQGGFTCHCSPGRKGTFCELLDTKN
LIIKPAEFNGDSYVELSKLENVGRSFSLELWILAKAPDGMLVYNGQLLNGKGDFICVYLY
RGFVVFQFDLGSGPANITSSQVISVGTWHSIKVSRQDRDGFLQVDDGIVTTGSSGPPLNE
LNLELPLYVGGVPLGYEVSKEIKASAGFIGGIQRLVVNHNSWDDLSNSTFKSYNVKQYSG
VPCNQTCHNGGSCLPYLNTFVCLCPVNFNGNLCELGMDTSNRLTSVVSKTREDNPIRLSP
GNYLEFLNKVYKKRKEEHVNNYKMVIKTNSRNGILLWLGKKKSAKMDFICIGLINGFPQF
SFKLGKQNETIHIGSKVFVSDGKWHTITVHRRKKRGYIQTDDEIPVKKISNSSTSILTTN
GKLYIGGAPILPSGLPNEYYEGFSGCLESVTIDRKSLDLISNQKNLEFCQENEV
Download sequence
Identical sequences E0VXE0
vb|PHUM498630-PA|EEB18046.1|Agrin 121224.XP_002430784 XP_002430784.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]