SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002430890 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002430890
Domain Number 1 Region: 79-154
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 8.5e-32
Family Skp1 dimerisation domain-like 0.0000131
Further Details:      
 
Domain Number 2 Region: 3-64
Classification Level Classification E-value
Superfamily POZ domain 1.26e-17
Family BTB/POZ domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002430890
Sequence length 157
Comment (Pediculus humanus corporis)
Sequence
MPNIKLQSSDGEVFEVDVEVAKCSGTIKTMLEDLGMEDDDEEVVPLPNVNSVIQWATYHK
DDPPPPEDEEIKEKRTDDISSWDADFLKVDQGTLFELILAANYLDIKGLLDITCKTVANM
IKGKTPEEVRKTFNIKNDFTAAEEEQVRKENEWCEEK
Download sequence
Identical sequences E0VXP6
vb|PHUM503280-PA|EEB18152.1|conserved 121224.XP_002430890 XP_002430890.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]