SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002431184 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  121224.XP_002431184
Domain Number - Region: 96-153
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000327
Family Myosin rod fragments 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002431184
Sequence length 201
Comment (Pediculus humanus corporis)
Sequence
MEVAKLGFLLLRTLSKPIANTCKERAKQSPIFRKYICLPPAYFYNWCEVKTKMWILNLGQ
PVQVPPLNEAMAIELGANLLGEGILFTVAAAVLIIEYARQSAKQAAKDKEQEEEMNRLHT
TIRDLNFQMESQQAQIKGLFRHVYELDSKVVKLPWTLGQKQNIDEIIEKKIEKPDKIDNS
DVITEAITYLFSDILGGDNFT
Download sequence
Identical sequences E0VYJ0
vb|PHUM515090-PA|EEB18446.1|conserved 121224.XP_002431184 XP_002431184.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]