SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002431284 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002431284
Domain Number 1 Region: 26-60
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000046
Family Retrovirus zinc finger-like domains 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002431284
Sequence length 89
Comment (Pediculus humanus corporis)
Sequence
MQTKIGKMYMSQIIAQTRNIEGGTNNDKKSGAFRGPHKPLDEVTCYKCGLKGHYANRCPK
GHLAFLSKAQQNSSFSNSNENQNQTNSTT
Download sequence
Identical sequences E0VYU0
XP_002431284.1.24195 121224.XP_002431284 vb|PHUM519370-PA|EEB18546.1|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]