SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002431857 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002431857
Domain Number 1 Region: 16-97
Classification Level Classification E-value
Superfamily CAD & PB1 domains 6.67e-26
Family PB1 domain 0.00037
Further Details:      
 
Domain Number 2 Region: 133-251
Classification Level Classification E-value
Superfamily PDZ domain-like 6.18e-23
Family PDZ domain 0.00000259
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002431857
Sequence length 288
Comment (Pediculus humanus corporis)
Sequence
MSKNYAKNSSTTNSDKLEIKSKFAAEFKRLSISRSDAKNYEGFKGLIETYHNLKEIPIVI
SYIDPSDHDLLPINNDDNLARALLIAKPLLRLIIQRKGESFEELNGYGTFKSKNFISSIL
SGTTPGGSKRYPPISNPHDFRKVSEIIDVDVVPEAHRRVRLLKHGSDKPLGFYIRDGTSV
RVTPSGLEKMPGIFISRLVPGGLAESTGLLAVNDEVLEVNGIDVAGKTLDQVTDMMVANS
SNLIVTVKPANQRNTMAPLPRRGSFSRTSQMSNNSEEKFDEEDVVVTY
Download sequence
Identical sequences E0W0G3
vb|PHUM551890-PA|EEB19119.1|Partitioning 121224.XP_002431857 XP_002431857.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]