SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002432446 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002432446
Domain Number 1 Region: 528-647
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.33e-28
Family Calponin-homology domain, CH-domain 0.0016
Further Details:      
 
Domain Number 2 Region: 7-138
Classification Level Classification E-value
Superfamily Outer arm dynein light chain 1 6.8e-21
Family Outer arm dynein light chain 1 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002432446
Sequence length 652
Comment (Pediculus humanus corporis)
Sequence
MLFALSPTDLEICNTSNFWISVGINFVQYLPDCVLLITNNKLSSLPGDIGSMKNLMELNA
SCNEISYLPKSLGQLKCLKALDLRKNLLEELPIELTYLKLTLLDMSENRISSLPVELRLM
TYLEQLKLNDNPLISPPATICMRGRVHIFKFLETQVNKTDKKRGGGFDDSTGKRNHQRKS
DLRYPNGVASEMRVKRHTVDSGYSTSDGIDPKWAQDFRCGDGVNKTKLKTESIPVSNNNN
SNGDRLENINGSHSGCSTPSTISPGESFSNDDELINRTVLFQDQLEAKRLIRLQSNDRGL
IVNKSKEKSTTKGSTNGETLSPVYNNSSPIVGNNFNFDDKKKLEHVQTYREYKEARRLQR
AQTQDVYKIKYSNEGQQWANQSPTSENSNDDLSTLNNQFNHSKNNNNNNSSSNGNGNNKP
IQKVIPSRNSNYGGNSLANGETSSIPSYVKPSSPVKGSTTTLLTETLSKPSLSPLSGGRQ
TSNMMASPINSSMSRFRTNSNSPKPMKWNTDIPADKLSFTMRREFEKAKEEAELIEQLRN
HIEGRLKMSLPEEMGPALMDGVVLCHLANHVRPRSVASIHVPSPAVPKLTMARCRRNVDN
FLDACRKIGVEENMICFASDVLEGRGLVRVSITVAELLKFHTPKSPAHNTVP
Download sequence
Identical sequences E0W252
XP_002432446.1.24195 vb|PHUM584220-PA|EEB19708.1|calponin 121224.XP_002432446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]