SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002432820 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002432820
Domain Number 1 Region: 2-61
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.09e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002432820
Sequence length 167
Comment (Pediculus humanus corporis)
Sequence
MKANDRERNRMHLLNEALDRLRCVLPTYPTDTKLTKIETLRFAHNYIWALSQTLQVINNE
KLTISSSSSPPPNDFISDITSDNGGITVNVGNVVVSISDKGNMITSNTGSCAVAHQRKYN
NQTGSSSSSSVVKTTTDDDSSYYYNDFLTYYYGSPSSTDDGKFKTAS
Download sequence
Identical sequences E0W376
vb|PHUM601720-PA|EEB20082.1|conserved XP_002432820.1.24195 121224.XP_002432820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]