SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 123214.PERMA_0041 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  123214.PERMA_0041
Domain Number 1 Region: 420-523
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.42e-22
Family Cold shock DNA-binding domain-like 0.0031
Further Details:      
 
Domain Number 2 Region: 269-356
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.43e-19
Family Cold shock DNA-binding domain-like 0.0041
Further Details:      
 
Domain Number 3 Region: 172-261
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000104
Family Cold shock DNA-binding domain-like 0.019
Further Details:      
 
Domain Number 4 Region: 351-435
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000746
Family Cold shock DNA-binding domain-like 0.014
Further Details:      
 
Domain Number 5 Region: 11-108
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000035
Family Cold shock DNA-binding domain-like 0.023
Further Details:      
 
Domain Number 6 Region: 100-180
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000123
Family Cold shock DNA-binding domain-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 123214.PERMA_0041
Sequence length 550
Comment (Persephonella marina EX H1)
Sequence
MENFQSEFEKLLEESQDIPYYSKGERVTGVIVRIQDDYAFVDVGQKTEVVIDKNEINGLS
EGDQITAVYLGRRNKDGYLVISRRPLIFSEALQRVEDAFSKGEKIGAKLDKKINKGFLVD
LGGVKAFLPYSESGLRRDEELPPPEFDVYILRIDRDRKPPGIVVSRKKVLDEEIKRKRDE
IFSLLEEGKQVRGRVEKVQENGAVLSLERIVFGFLPRSLYSWDRDRSISELSVGDEIDLV
VKSIDRENQKIIFSKRDLEPDPWKTFDKEVGDQIEVEIKDINDFGLIVKTGALEGFIHKS
ETSHLRPENYKNSFRKGQKVKAKIIELDRENRRLKLSIKALHPHPVDKFLEENPEGSVVE
GKIKEIRNKIAFVDLGKDVEGVIHLEDATWNPKIKNIGQVLKGKRLREFKVLGREKDKVR
LGIKQFRDNPWEEFFSKHSVGDVIKAKVKKLIDRGAFVDINEDVEGFIPLSEISKEKIEI
PSDKLSLGQEIEAKIIKIKGHDIILSIKALEKDKEKKEIEEVMRKVKPKGEGLATLGELL
KEKLKGENKA
Download sequence
Identical sequences C0QT24
123214.PERMA_0041 gi|225849605|ref|YP_002729839.1| WP_012676834.1.53201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]