SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 123214.PERMA_0067 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  123214.PERMA_0067
Domain Number 1 Region: 7-102
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.68e-28
Family Thioredoxin-like 2Fe-2S ferredoxin 0.0000581
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 123214.PERMA_0067
Sequence length 109
Comment (Persephonella marina EX H1)
Sequence
MSAEFKHVFVCLQRKPPGMPNCGEKGADMIFQKFQEELMMKNLFDKMAVTPTGCMGPCMM
GPTVVVYPDAVWYGNVKPEDVPEIIEKHILGGEPVERLVTSKGKPPATF
Download sequence
Identical sequences C0QT50
gi|225849631|ref|YP_002729865.1| WP_012675239.1.53201 123214.PERMA_0067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]