SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 123214.PERMA_0069 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  123214.PERMA_0069
Domain Number 1 Region: 353-506
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 5.83e-31
Family HD domain 0.033
Further Details:      
 
Domain Number 2 Region: 238-336
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.42e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 123214.PERMA_0069
Sequence length 553
Comment (Persephonella marina EX H1)
Sequence
MVEIVVGISALAVGTAAGFAACKATVGKTLKEKERKAEEIIKNKEEIEREARRKAEEIIK
EFEAEAKRKAEEIVREAESLKQQQEIIIEKEILKRKQELEKELKSEREELQNLEKTLMSR
EAQLEKRLARLEHREEELDKKWDEIKKLEEEIRSIQKEIEEKEAKLKAAEEQYMLELQRI
ASMTKEEAREELLRKVEEEAKLEAAKLMKEIEEEARKEAEKEAKWNLVTAIQRLAPEITT
SHTISVVDLPSNDLKGRIIGREGRNIRAFEMETGVDLIIDDTPDIVTISSFDPLRREIAK
RSLERLIADGRIHPGRIEEIVTKVKDEMESHIRKLGEETCLELGFTDVHPELFYYIGKLY
YRTSYTQNVLLHTKEVAHLAGIMAAELGLDEKAAKRGGLMHDVGKSISHEVGGSHSKVGA
ELAKRYGEPDVVINAILYHHNDEPARYPEAVLVAAADALSAARPGARREALQSYINRLEK
IEAIVNSFENVEKSFAIQAGREVRIIVNAEKLSDEEAYMLTKEIAKRIEKEVEFPGQIKI
TTIRESRFIEVAK
Download sequence
Identical sequences C0QT52
gi|225849633|ref|YP_002729867.1| 123214.PERMA_0069 WP_012675875.1.53201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]