SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 123214.PERMA_0242 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  123214.PERMA_0242
Domain Number 1 Region: 300-492
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.59e-51
Family Ribonuclease PH domain 1-like 0.0000235
Further Details:      
 
Domain Number 2 Region: 12-149
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.62e-43
Family Ribonuclease PH domain 1-like 0.0000709
Further Details:      
 
Domain Number 3 Region: 150-238
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.24e-29
Family Ribonuclease PH domain 2-like 0.00097
Further Details:      
 
Domain Number 4 Region: 454-552
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.44e-29
Family Ribonuclease PH domain 2-like 0.0000925
Further Details:      
 
Domain Number 5 Region: 559-644
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.28e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0028
Further Details:      
 
Domain Number 6 Region: 622-700
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.57e-17
Family Cold shock DNA-binding domain-like 0.00068
Further Details:      
 
Domain Number 7 Region: 244-323
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000000000392
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 123214.PERMA_0242
Sequence length 709
Comment (Persephonella marina EX H1)
Sequence
MEGIGDITVEKVETKIQETPISIETGYFAKQSNGAVIVRQGETAVFVAAVISEEAQADID
FLPLTVDYREKTYAYGKIPGGFVKREGKPTVREILVSRLIDRPIRPMFPKGFFNDVIITA
MTLSADDKYDPDVLAIVGASAALHITEAPFEGPVAGVRVCRLDGEFIVNPTYEQRNRSDI
DIVVAGTKDAIVMVEGGSEEVSEEVILDAILFAHEEIKKLCDLQEELRSKVGKEKITVEI
DEEDERIKAELESIVRESVKEAFNILDKKERNKRIKEIYEEAIQKIEIPEEKEKKAEVIY
KEIVSNIMREKVLKEKVRIDGRRPDEIRPIWIRTGLFPRIHGSAIFTRGQTQAFVATTLG
APGEEQIEESIEEGEEKKRFMLHYNFPPFSTGEARPPRAPSRREIGHGNLAERAIEPLIP
DEEEFPYVIRVVSEILESNGSTSMATVCGASLSLFDAGVPMKKHVAGIAMGLLKEDDDYV
ILTDILGDEDHLGDMDFKVAGTRDGVTSIQMDIKIKGLSKEILQEALEQAKKARMHILDL
MYKAMPQPRPELSPHAPKVITMRVLPEKIPVIIGPSGKNIKKIIDETGVKIDLDQEGLVR
IYAVDGESADKAKEMIERLIMDIELGEVYMGKVTRVEDYGAFVELMPGKLSLLHVSQISP
ERIRSAKEKIKVGDILTVKVIDIDEMGRAKVSLKEVREGEEPKNKFLFE
Download sequence
Identical sequences C0QTM3
gi|225849804|ref|YP_002730038.1| 123214.PERMA_0242 WP_012676485.1.53201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]