SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 123214.PERMA_1212 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  123214.PERMA_1212
Domain Number 1 Region: 6-121
Classification Level Classification E-value
Superfamily Translational machinery components 1.33e-50
Family Ribosomal protein L18 and S11 0.0000463
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 123214.PERMA_1212
Sequence length 123
Comment (Persephonella marina EX H1)
Sequence
MAVKTRREKRLIRHKRIRKKVFGTAERPRMAFFKSLNNLYVQIIDDEAGHTLVSASTIDK
DFVEKYGVRGGKNIEMAKKLGEFIAEKALAKGIQNVVFDRGGFIYHGKVKAFADAAREKG
LKF
Download sequence
Identical sequences C0QQN9
gi|225850751|ref|YP_002730985.1| WP_012676563.1.53201 123214.PERMA_1212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]