SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 123214.PERMA_1593 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  123214.PERMA_1593
Domain Number - Region: 19-81
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.045
Family IMD domain 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 123214.PERMA_1593
Sequence length 87
Comment (Persephonella marina EX H1)
Sequence
MRTIILLLTFLIFSLSYGVEIRSDIRLEIISQIKLLQEEKEKLKKDILNADSDEKVYIRK
KIKKIDKKIEKLNDLLEHYEKNISNAG
Download sequence
Identical sequences C0QRR4
123214.PERMA_1593 gi|225851126|ref|YP_002731360.1| WP_012676570.1.53201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]