SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 123214.PERMA_1831 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  123214.PERMA_1831
Domain Number 1 Region: 143-306
Classification Level Classification E-value
Superfamily TPR-like 6.33e-20
Family Tetratricopeptide repeat (TPR) 0.0084
Further Details:      
 
Weak hits

Sequence:  123214.PERMA_1831
Domain Number - Region: 67-151
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000196
Family Pseudo ankyrin repeat 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 123214.PERMA_1831
Sequence length 326
Comment (Persephonella marina EX H1)
Sequence
MSLTGKFLTKKREEIDSESADIHPFSRVKPKRKKNVLIFFLILTAIFIYAGIFFLEISGD
TGKNKEIQVSQKQEIVLKEHQEKKQTKKIKTLNYPPVNIKIEQVKSEIDRVFKNSRVLTL
VPQKPSFKKETNKVKRETKRDKIISYIRKGKEAEKRGDIKSAIYFYKQAWRLNKSNSDII
FKIADLHYRGGYYKASIKYANRTLKVKKDYIPAIILKAKAYEALGMREKSKAILEEAYFM
YPENKKIIYNLAHLYEKERSLVIAKDLYKILDEMGYIEGSLGLARVNEKLGYKDKAYRIY
KRLLKHPDLSKELRYRIEEKLLLLGD
Download sequence
Identical sequences C0QSE7
123214.PERMA_1831 gi|225851359|ref|YP_002731593.1| WP_012676750.1.53201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]