SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 126740.TRQ2_0220 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  126740.TRQ2_0220
Domain Number 1 Region: 4-214
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 9.94e-39
Family LplA-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 126740.TRQ2_0220
Sequence length 236
Comment (Thermotoga RQ2)
Sequence
MIEKGVFPGALNMAIDSLMAEWSANMNSVLFRFYGWERPTVSLGRFQKEDGINVPDWIDV
VRRPSGGRALLHHREITYCLAVPKKINFGKLSVLEFHRLVHSLIRDALVEAGLHAELSSE
RRGNTALCFDAPSRYEIVINGVKVVGSAQFRTAESIVEHGSIVLKQDIDLLKTIFGEDVP
PLKGILDLYDVDVKAMEERILAQFEKVFGTSRKIQLDSSMLKEARERSPLYKVRRR
Download sequence
Identical sequences A0A0F6AJG4
WP_012310399.1.32102 126740.TRQ2_0220 gi|170288025|ref|YP_001738263.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]