SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 126740.TRQ2_0665 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  126740.TRQ2_0665
Domain Number 1 Region: 21-247
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.99e-36
Family Clostridium neurotoxins, the second last domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 126740.TRQ2_0665
Sequence length 250
Comment (Thermotoga RQ2)
Sequence
MKKSFWVVTLGLLILLGACALIQQPVSFDPFADESLLVYFPFDGTLEGIVKGATATAITC
GSTIGTPGGTITYVEGKKGEAAVFDGTSGVVLPDDIVNDYDYTIAFWVNMHAFTDHTPTV
FGSSEVGWISYMVPKPWWRNPGEPAIWSLSGEQWSTYEMDTLLSSNTWYHVAIVVDEGNP
KAYVNGATVSLSSIEGLPLPDIFTDATATIAVGVNYWDPPFQGMIDELFIFDRSLSRSEI
LTLYNLGYGE
Download sequence
Identical sequences A0A101FB88 Q7WU64
WP_012310666.1.32102 gi|170288463|ref|YP_001738701.1| 126740.TRQ2_0665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]