SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 126740.TRQ2_0666 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  126740.TRQ2_0666
Domain Number 1 Region: 41-255
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.61e-40
Family Trypanosoma sialidase, C-terminal domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 126740.TRQ2_0666
Sequence length 258
Comment (Thermotoga RQ2)
Sequence
MKKSLLVILVASIVLLTLAAQCFRAESAESFDPDRDEALTAWFPFDGDLADKTGKFGSGK
VIGDKIEKETADGTVEFVEGVSGQAVYLDGTKGIQLPDDLIKDYDYTVSFWMKWEGDITP
FTPVFFGAYDPNSWISIPPYHSAVAGGSFLLWSFSDYWYDGILNVSFKPGTWYHVAAVVN
NGRARVYVNGKYVLSKIQINGVEDMTGKVPDVFRKKPGGIFTVGVNWWDPTFKGVVDDLR
IYDRPLSKSEIEVLYGKR
Download sequence
Identical sequences Q7WU63
gi|170288464|ref|YP_001738702.1| WP_012310667.1.32102 126740.TRQ2_0666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]