SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 126740.TRQ2_1061 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  126740.TRQ2_1061
Domain Number 1 Region: 128-185
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.71e-19
Family Cold shock DNA-binding domain-like 0.00043
Further Details:      
 
Domain Number 2 Region: 68-127
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.36e-18
Family Cold shock DNA-binding domain-like 0.0016
Further Details:      
 
Domain Number 3 Region: 1-62
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1.71e-17
Family eIF5a N-terminal domain-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 126740.TRQ2_1061
Sequence length 185
Comment (Thermotoga RQ2)
Sequence
MIEVGDLKKGMFIIYDGEIYRVLEASKHFMGRGSGLIRTKLKNVKTGLVREVNFPSGDKV
PEAELSFRKAQYLYRDGDHYYFMTLDDYEQYALSEEEIGDAKYYLVENMEVDLVFHEGTP
IGIELPTTVELTVVETEPSFKGDTVSGGGKPAVLETGLKITVPYFIEVGDKIKVDTRTGE
YVGRA
Download sequence
Identical sequences A0A117L2B3 A0A117L8Y5 A5ILJ5 B1LAR0 D2C852
gi|170288853|ref|YP_001739091.1| 126740.TRQ2_1061 390874.Tpet_1051 590168.Tnap_1051 gi|148270184|ref|YP_001244644.1| WP_011943598.1.18251 WP_011943598.1.32102 WP_011943598.1.44660 WP_011943598.1.5118 WP_011943598.1.51822 WP_011943598.1.75526 WP_011943598.1.89131 gi|281412473|ref|YP_003346552.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]