SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN00008 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN00008
Domain Number 1 Region: 28-156
Classification Level Classification E-value
Superfamily PapD-like 2.62e-24
Family MSP-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN00008
Sequence length 157
Comment (Caenorhabditis brenneri)
Sequence
MADKKSQNQVSTSQCPTNNPFHDAGATSLLNKTGEPPFKLSLNLNKVEFKCTDDKKPIPV
HLKVFNPTNETVCYKVRCTSAEIFRVQPPLGFVKAQETITIIIWYQNQDNKKEALSNKLH
YFAIYHTHSDGRTARELWANSKVEGVRRLPATFIMAN
Download sequence
Identical sequences G0N861
CBN00008 CBN24205 135651.CBN00008 135651.CBN24205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]