SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN00211 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  135651.CBN00211
Domain Number - Region: 14-96
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00333
Family Galectin (animal S-lectin) 0.029
Further Details:      
 
Domain Number - Region: 165-184
Classification Level Classification E-value
Superfamily Granulin repeat 0.0569
Family Granulin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN00211
Sequence length 188
Comment (Caenorhabditis brenneri)
Sequence
MIMVIRKIKITCPRTKKKEVSFWSEVNNDYDEGERRKLVWPRDSVMVEIDVKEHYFQIII
ENDWYKSYEQRMSMFECKRFTVVSVNGVVNIVEILYPAKPKESWIEDEEPESNSTEEEEH
SSLIQRPSNRAKNDDDFFPTSKANDRSGYPDNKTTGYKDHDTTGYKDQDTTCCSTIPTVF
NCCFLVFL
Download sequence
Identical sequences G0NIQ5
CBN00211 135651.CBN00211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]