SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN00228 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN00228
Domain Number 1 Region: 7-247
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.71e-68
Family Calponin-homology domain, CH-domain 0.00012
Further Details:      
 
Domain Number 2 Region: 713-829
Classification Level Classification E-value
Superfamily E set domains 2.17e-25
Family Filamin repeat (rod domain) 0.00071
Further Details:      
 
Domain Number 3 Region: 956-1044
Classification Level Classification E-value
Superfamily E set domains 2.14e-23
Family Filamin repeat (rod domain) 0.001
Further Details:      
 
Domain Number 4 Region: 539-633
Classification Level Classification E-value
Superfamily E set domains 1.07e-21
Family Filamin repeat (rod domain) 0.0004
Further Details:      
 
Domain Number 5 Region: 818-919
Classification Level Classification E-value
Superfamily E set domains 4.87e-17
Family Filamin repeat (rod domain) 0.0012
Further Details:      
 
Domain Number 6 Region: 638-733
Classification Level Classification E-value
Superfamily E set domains 0.00000000154
Family Filamin repeat (rod domain) 0.015
Further Details:      
 
Domain Number 7 Region: 364-446
Classification Level Classification E-value
Superfamily E set domains 0.0000000238
Family Filamin repeat (rod domain) 0.011
Further Details:      
 
Domain Number 8 Region: 258-337
Classification Level Classification E-value
Superfamily E set domains 0.00000166
Family Filamin repeat (rod domain) 0.039
Further Details:      
 
Weak hits

Sequence:  135651.CBN00228
Domain Number - Region: 478-556
Classification Level Classification E-value
Superfamily E set domains 0.0507
Family Filamin repeat (rod domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN00228
Sequence length 1088
Comment (Caenorhabditis brenneri)
Sequence
MAQPKRHDQEEEVVPAIRHEDAEWKLIQQNTFTRWVNNHLQKAGESIGSLETEFSDGLKL
IALAQVLSHKTVGKFNKKVAFRSQKLENVSLALNFFQNEENIKIINIDSTHIVDHNKKLI
LGLVWTLILHYSISMGWIQEKREDGEKEETPKQKLLNWIRNRLPGMPISNFTSDWNDGVA
LGALVNSMAPGALEDWENWSPNEALENTEKAMKSAQDLLKVAPLIAPAEMIHPEIDEMSV
MTYLSQFPATKPVVVKPKVHATISNLDKTLLINNPREFDLKFSRDGYKPKVSIRDADGQD
VHLAVKKVDDEATTYKIKFTPTKIGPLHVEVGATDIHTFETQAIPEATTTCQVVPIARLL
EYTKNAKVGDEIKFTVVDAIEGPVEAIIVEPNATEHRMVILEGSAPGEYTFEYKLPSVGL
HSVNIFHKKVPLTGSPFPLRAKPKNSFKIWGRGIVPEGVRKNDVVGVHVKSLDPDENIAK
ANVSLEVVKKDGTHLPVSVGYDEEDATLHFEYEPKEAPEELEVLVKVAGEKIESHKVHVS
PLSSSKIRAFGPGLEGGVVNEPCVFDVEMNGESKDLSFAVEGPSKAEIGCDERPDGSAVL
SYTPTVAGVYKVGVLADGEHIRDSPFVLRVTEPVPGLKPSATRVTGIDESKLYSVGEKIP
FRVDTRLCGVDLVPKVEILDSSLNKIVYGAREITPGIFEYTLVPEHAVKHKIDVSVGGVS
VPGAPFSIKVKEATDASKLRIYGPGVEGPVYSKEPTRFTIDATQAGPGAVEVALADDHGE
KVDLDVLDNQDGSFTVKYTAQRPGAYQLNVVFAGEQISPIAINVKPNVDTSGIRVDGLEN
AVVTVNVEKEIHVFTTDGENTRIVITSPSGRVVEAIIESTPTGFRVRFTPSEVGNYTIDV
TYQDIPIERSPFTLQSIDPNQPEGSSEMDYDEAEQDPGASTLAEAEYVVCGSGPPRADLV
TVSGPGLGPLVAQRSTFVSIDTTNAGFGDIDVYVDGPTRTPLHCVDNQDGILKMCFTPKQ
PGLYYLRVMFDNEHVPGSPFQIVAVAALLGSPSLLGADQRSKTESPYSSISSGSSSTPNP
TANPQACT
Download sequence
Identical sequences 135651.CBN00228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]