SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN00624 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN00624
Domain Number 1 Region: 5-99
Classification Level Classification E-value
Superfamily POZ domain 1.02e-28
Family Tetramerization domain of potassium channels 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN00624
Sequence length 203
Comment (Caenorhabditis brenneri)
Sequence
MSSGNIVKLNIGGTIFQTTKSTLTKFGGYFKTRLESGIPLERDDDGAIFVDRSPKHFGLI
LNFMRDGEVGLPECPNQLKEVLKEAQFYCLEDLQKLCVMGKELIPRNNNHFLDTIKEVIN
ASLNCTKKAVIMIPYHPDNYAEENRALIMSTELQKYVTDFDVYFVSSKAVTLANCRIRDT
TSGKVNFVAWEEVEQFMKNNYGV
Download sequence
Identical sequences G0MYJ8
CBN00624 135651.CBN00624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]