SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN00946 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN00946
Domain Number 1 Region: 157-299
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.11e-23
Family Galectin (animal S-lectin) 0.0066
Further Details:      
 
Domain Number 2 Region: 18-136
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.01e-23
Family Galectin (animal S-lectin) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN00946
Sequence length 301
Comment (Caenorhabditis brenneri)
Sequence
MSLPSAPPAEEDSIIRSPELPFVSSIVGGLFAGRAVVVSGMVLPGFASDRKKFDIDLCCG
LLIDGDHMDNKALHFNPRFEAKAGWFSGPADDKLVINSFVSGGWGAEERFDNPFKEGEPF
QLRILVLEKYFKIGIDANGKPTLVAPTPRQEVITQIDKPNIPFVLPLPMGGFVSPQSARF
TITPFLSAERFTINLMSKNEFLFHFRVDMPNPAQKIKPAVVRNSSKNGVQWQTEERTFAS
FPFSKGITHDVVFTAYGKSVTVDVDGAPFVKFVYRDGDDPINIDAITVKGDVLVHRFVHK
G
Download sequence
Identical sequences G0PEE3
CBN00946 135651.CBN00946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]